KEGG   Pan paniscus (bonobo): 100972534Help
Entry
100972534         CDS       T02283                                 

Gene name
SMUG1
Definition
single-strand-selective monofunctional uracil-DNA glycosylase 1
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
pps  Pan paniscus (bonobo)
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:pps03410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 270 aa AA seqDB search
MPQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEY
AWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSMVRDWLGIVGPVLTPPQE
HPKRPVLGLECPQSEVSGARFWGFFRNLCGQPEVFFHHCFVHNLCPLLFLAPSGRNLTPA
ELPAKQREQLLGICDAALCRQVQLLGVRLVVGVGRLAEQRARRALAGLMPEVQVEGLLHP
SPRNPQANKGWEAVAKERLNELGLLPLLLK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgccccaggctttcctgctggggtccatccatgagcctgcaggtgccctgatggagccc
cagccctgccctggaagcttggctgagagcttcctggaggaggagcttcggctcaatgct
gagctgagccagctgcagttttcggagcctgtgggcatcatctacaatcccgtggagtat
gcatgggagccacatcgcaactacgtgactcgctactgccagggccccaaggaagtactc
ttcctgggcatgaaccctggaccttttggcatggcccagactggggtgccctttggggaa
gtaagcatggtccgggactggttgggcattgtggggcctgtgctgacccctccccaagag
catcctaaacgaccagtgctgggactggagtgcccacagtcagaagtgagtggtgcccga
ttctggggctttttccggaacctctgtggacagcctgaggtcttcttccatcactgtttt
gtccacaatctatgccctctgcttttcctggctcccagcgggcgcaaccttactcctgct
gagctgcctgccaagcagcgagaacagcttcttgggatctgtgatgcagccctctgccgg
caggtgcagctactgggggtgcggctggtggtgggagttgggcgactggcagagcagcgg
gcacgacgggctctggcaggcctgatgccagaggtccaggtggaagggctcctgcatccc
tctccccgtaacccacaggccaacaagggctgggaggcagtggccaaggaaagattgaat
gagctggggctgctgccactgctgttgaaatga

DBGET integrated database retrieval system