KEGG   Pan paniscus (bonobo): 100972773Help
Entry
100972773         CDS       T02283                                 

Gene name
CDC27
Definition
cell division cycle 27 homolog (S. cerevisiae)
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
pps  Pan paniscus (bonobo)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:pps00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100972773 (CDC27)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100972773 (CDC27)
   04114 Oocyte meiosis
    100972773 (CDC27)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100972773 (CDC27)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    100972773 (CDC27)
Protein phosphatases and associated proteins [BR:pps01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100972773 (CDC27)
Ubiquitin system [BR:pps04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     100972773 (CDC27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 824 aa AA seqDB search
MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRL
LKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSL
LGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKFTSLQNFSNCL
PNSCTTQVPNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVI
SPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQN
YTNTPSVIDVPSTGAPSKKSVARIGQTGTKSVFSQSGNSREVTPILAQTQSSGPQTSTTP
QVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGITQ
PNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSYN
CKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYS
TTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNY
AYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQK
ALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYK
SALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAID
KRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgctgcaggaacccgtccaggctgctatatggcaagcactaaaccactatgct
taccgagatgcggttttcctcgcagaacgcctttatgcagaagtacactcagaagaagcc
ttgtttttactggcaacctgttattaccgctcaggaaaggcatataaagcatatagactc
ttgaaaggacacagttgtactacaccgcaatgcaaatacctgcttgcaaaatgttgtgtt
gatctcagcaagcttgcagaaggggaacaaatcttatctggtggagtgtttaataagcag
aaaagccatgatgatattgttactgagtttggtgattcagcttgctttactctttcattg
ttgggacatgtatattgcaagacagatcggcttgccaaaggatcagaatgttaccaaaag
agccttagtttaaatcctttcctctggtctccctttgaatcattatgtgaaataggtgaa
aagccagatcctgaccaaacatttaaattcacatctttacagaactttagcaactgtctg
cccaactcttgcacaacacaagtacctaatcatagtttatctcacagacagcctgagaca
gttcttacggaaacaccccaggacacaattgaattaaacagattgaatttagaatcttcc
aattcaaagtactccttgaatacagattcctcagtgtcttatattgattcagctgtaatt
tcacctgatactgtcccactgggaacaggaacttccatattatctaaacaggttcaaaat
aaaccaaaaactggtcgaagtttattaggaggaccagcagctcttagtccattaacccca
agttttgggattttgccattagaaaccccaagtcctggagatggatcctatttacaaaac
tacactaatacaccttctgtaattgatgtgccatccaccggagccccttcaaaaaagtct
gttgccagaatcggccaaactggaacaaagtctgtcttctcacagagtggaaatagccga
gaggtaactccaattcttgcacaaacacaaagttctggtccacaaacaagtacaacacct
caggtattgagccccactattacatctcccccaaacgcactgcctcgaagaagttcacga
ctctttactagtgacagctccacaaccaaggagaatagcaaaaaattaaaaatgaagttt
ccacctaaaatcccaaacagaaaaacaaaaagtaaaactaataaaggaggaataactcaa
cctaacataaatgatagcctggaaattacaaaattggactcttccatcatttcagaaggg
aaaatatccacaatcacacctcagattcaggcctttaatctacaaaaagcagcagcagaa
ggtttgatgagccttcttcgtgaaatggggaaaggttatttagctttgtgttcatacaac
tgcaaagaagctataaatattttgagccatctaccttctcaccactacaatactggttgg
gtactgtgccaaattggaagggcctattttgaactttcagagtacatgcaagctgaaaga
atattctcagaggttagaaggattgagaattatagagttgaaggcatggagatctactct
acaacactttggcatcttcaaaaagatgttgctctttcagttctgtcaaaagacttaaca
gacatggataaaaattcgccagaggcctggtgtgctgcagggaactgtttcagtctgcaa
cgggaacatgatattgcaattaaattcttccagagagctatccaagttgatccaaattat
gcttatgcctatactctattagggcatgagtttgtcttaactgaagaattggacaaagca
ttagcttgttttcgaaatgctatcagagtcaatcctagacattataatgcatggtatggt
ttaggaatgatttattacaagcaagaaaaattcagccttgcagaaatgcatttccaaaaa
gcgcttgatatcaaccctcaaagttcagttttactttgccacattggagtagttcaacat
gcactgaaaaaatcagagaaggctttggataccctaaacaaagccattgtcattgatccc
aagaaccctctatgcaaatttcacagagcctcagttttatttgcaaatgaaaaatataag
tctgctttacaagaacttgaagaattgaaacaaattgttcccaaagaatccctcgtttac
ttcttaataggaaaggtttacaagaagttaggtcaaacgcacctcgccctgatgaatttc
tcttgggctatggatttagatcctaaaggagccaataaccagattaaagaggcaattgat
aagcgttatcttccagatgatgaggagccaataacccaagaagaacagatcatgggaaca
gatgaatcccaggagagcagcatgacagatgcggatgacacacaacttcatgcagctgaa
agtgatgaattttaa

DBGET integrated database retrieval system