KEGG   Pan paniscus (bonobo): 100972918Help
Entry
100972918         CDS       T02283                                 

Gene name
ARHGEF1
Definition
Rho guanine nucleotide exchange factor (GEF) 1
Orthology
K12330  
Rho guanine nucleotide exchange factor 1
Organism
pps  Pan paniscus (bonobo)
Pathway
Vascular smooth muscle contraction
Platelet activation
Regulation of actin cytoskeleton
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100972918 (ARHGEF1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100972918 (ARHGEF1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    100972918 (ARHGEF1)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100972918 (ARHGEF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 927 aa AA seqDB search
MASLSTWSSPAEPREMEDFARGAASPGPSRPGLVPVSIIGAEDEDFENELETNSEEQNSQ
FQSLEQVKRRPAHLMALLQHVALQFEPGPLLCCLHADMLGSLGPKEAKKAFLDFYHSFLE
KTAVLRVPVPPNVAFELDRTRADLISEDVQRRFVQEVVQSQQAAVGRQLEDFRSKRLMGM
TPWEQELAQLEAWVGRDRASYEARERHVAERLLMHLEEMQHTISTDEEKSAAVVNAIGLY
MRHLGVRTKSGDKKSGRNFFRKKVMGNRRSDEPAKTKKGLSSILDAARWNRGEPQVPDFR
HLKAEVDAEKPGSTDRKGGVGMPSRDRNIGAPGQDTPGVCLHPLSLDSPDREPGADAPLE
LGDSSPQGPMSLESLAPPESTDEGAETESPEPGDEGEPGRSGLELEPEEPPGWRELVPPD
TLHSLPKSQVKRQEVISELLVTEAAHVRMLRVLHDLFFQPMAECLFFPLEELQNIFPSLD
ELIEVHSLFLDSLVKRRQESGYLIEEIGDVLLARFDGAEGSWFQKISSRFCSRQSFALEQ
LKAKQRKDPRFCAFVQEAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEEPTER
EKVELAAECCREILHHVNQAVRDMEDLLRLKDYQRRLDLSHLRQSSDPMLSEFKNLDITK
KKLVHEGPLTWRVTKDKAVEVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDGKTMLR
PVLRLTSAMTREVATDHKAFYVLFTWDQEAQIYELVAQTVSERKNWCALITETAGSLKVP
APASRPKPRPSPSSTREPLLSSSENGNGGRETSPADARTERILSDLLPFCRPGPEGQLAA
TALRKVLSLKQLLFPAEEDNGAGPPRDGDGVPGGGPLSSARTQEIQENLLSLEETMKQLE
ELEEEFCRLRPLLSQLGGNSVPQPGCT
NT seq 2784 nt NT seq  +upstreamnt  +downstreamnt
atggcttctctttccacctggagcagccctgcagagcccagggagatggaagacttcgcc
cgaggggcggcctccccaggcccctcccggcctggcctggttcccgtcagcatcatcggg
gctgaggatgaggattttgagaacgagctggagacaaactcggaagagcaaaacagccag
ttccagagcctggagcaggtgaagcggcgcccagcccacctcatggccctcctgcagcac
gtggccctgcagtttgagccaggacccctgctttgctgtctgcatgccgacatgctgggc
tcactgggccccaaggaggccaagaaggccttcctggacttctaccacagcttcctggag
aagacagcggttctccgggtgccggtccctcccaacgtcgcctttgaacttgaccgcact
agggctgacctcatctccgaggatgtccagcggcggttcgtgcaggaggtggtgcaaagc
cagcaggcagccgtgggccggcagctggaggacttccgctccaagcggctcatgggcatg
acgccctgggagcaggagctggcccagctggaggcttgggttgggcgggaccgagccagc
tacgaggcccgggagcggcacgtggctgagcggctgctcatgcacctggaggagatgcaa
cataccatctctaccgacgaagaaaagagtgctgccgtggtcaacgccattggcctgtac
atgcgccaccttggggtgcggaccaagagtggagacaagaagtcggggaggaacttcttc
cggaaaaaggtgatggggaaccggcggtcggacgagcctgccaagaccaagaaggggctg
agcagcatcctggatgccgcccgctggaaccggggagagccccaggttccagattttcga
cacctcaaagcagaggttgatgccgagaagccaggttctacagaccggaagggaggcgtg
gggatgccctctcgggaccggaatatcggggctcctgggcaggacacccctggagtctgt
ctgcaccctctgtccctggacagcccagaccgggaaccaggtgctgacgcccccctggag
ctgggggactcatccccacagggcccaatgagcctggagtccttggcgcccccagagagt
accgatgagggggccgaaaccgagagccccgagcctggagatgagggggagccggggcgg
tcgggactggagcttgaaccagaagagcctcccggctggcgggaactcgtccccccagac
accctgcacagcctgcccaagagccaggtgaagcggcaggaggtcatcagcgagctgctg
gtgacagaggcggcccacgtgcgcatgctgcgggtgctgcacgacctcttcttccagccc
atggcagaatgcctgttcttccccttggaggagctgcagaacatcttccccagcctggac
gagctcatcgaggtgcattccctgttcctcgattccctggtgaagcggaggcaggagagt
ggctacctcatcgaggagatcggagacgtgctgctggcccggtttgatggtgctgagggc
tcctggttccagaaaatctcctcccgcttctgcagccgccagtcatttgccttagagcag
ctcaaagccaagcaacgcaaggaccctcggttctgtgccttcgtgcaggaagctgagagc
cgcccgcggtgccgccgcctgcagctgaaggacatgatccccacggagatgcagcggcta
accaagtaccccctgctcctgcagagcatcgggcagaacacagaagagcccacagaacgg
gagaaagtggagctggcagccgagtgctgccgggaaattctacaccacgtcaaccaagcc
gtgcgtgacatggaggacctgctgaggctcaaggactatcagcggcgcctggacttgtcc
caccttcggcagagcagcgaccctatgctgagcgaattcaagaacctggacatcaccaag
aaaaaattggtccacgagggcccactgacgtggcgggtgactaaggacaaggcagtggag
gtgcatgtgctgctgctggacgacctgctgctgctgctccagcgccaggacgagcggctg
ctgctcaagtcccatagccggacactgacgcccacacccgatggcaagaccatgctgcgg
cccgtgctgcggctcacctccgccatgacccgcgaggtggccaccgatcacaaagccttc
tacgtcctttttacctgggaccaggaggcccagatatacgagctggtggcacagactgtg
tcggagcggaaaaactggtgtgccctcatcactgagactgccggatccctgaaagtccct
gcccctgcctctcgccctaagccccggcccagcccgagcagcacccgagaacccctcctc
agcagctctgagaacggcaatggtggccgagagacgtctccagctgatgcccggactgag
agaatcctcagtgacctcctgcccttctgcagaccaggccccgagggccagctcgctgcc
acggcccttcggaaagtgctgtccctgaagcagcttctgtttccggcggaggaagacaat
ggggcggggcctcctcgagatggggatggggtcccagggggcggccccctgagctcagca
cggacccaggaaatccaggagaacctgctcagcttggaggagaccatgaagcagctggag
gagttggaggaggaattttgccgcctgcgacccctcctgtctcagcttggggggaactct
gtcccccagcctggctgcacttga

DBGET integrated database retrieval system