KEGG   Pan paniscus (bonobo): 100973813Help
Entry
100973813         CDS       T02283                                 

Gene name
UGT2A1
Definition
(RefSeq) UDP-glucuronosyltransferase 2A1
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00040  Pentose and glucuronate interconversions
pps00053  Ascorbate and aldarate metabolism
pps00140  Steroid hormone biosynthesis
pps00830  Retinol metabolism
pps00860  Porphyrin and chlorophyll metabolism
pps00980  Metabolism of xenobiotics by cytochrome P450
pps00982  Drug metabolism - cytochrome P450
pps00983  Drug metabolism - other enzymes
pps01100  Metabolic pathways
pps05204  Chemical carcinogenesis
Module
pps_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100973813 (UGT2A1)
   00053 Ascorbate and aldarate metabolism
    100973813 (UGT2A1)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100973813 (UGT2A1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100973813 (UGT2A1)
   00860 Porphyrin and chlorophyll metabolism
    100973813 (UGT2A1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100973813 (UGT2A1)
   00982 Drug metabolism - cytochrome P450
    100973813 (UGT2A1)
   00983 Drug metabolism - other enzymes
    100973813 (UGT2A1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100973813 (UGT2A1)
Enzymes [BR:pps01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100973813 (UGT2A1)
Glycosyltransferases [BR:pps01003]
 Others
  Hydrophobic molecule
   100973813 (UGT2A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Pro_3_hydrox_C
Motif
Other DBs
NCBI-GeneID: 100973813
NCBI-ProteinID: XP_003809064
Position
4
AA seq 557 aa AA seqDB search
MSNECCSSRKLQQRKTFASHLIKSSASSHIMLNNLLLFSLQISLIGTTLGGNVLIWPMEG
SHWLNVKIIIDELIKKEHNVTVLVASGALFITPTSNPSLTFEIYKVPFGKERIEGVIKDF
VLTWLENRPSPSTIWRFYQEMAKVIKDFHMVSQEICDGVLKNQQLMEKLKKSKFEVLVSD
PVFPCGDIVALKLGIPFMYSLRFSPASTVEKHCGKVPYPPSYVPAVLSELTDQMSFTDRI
RNFISYHLQDYMFETLWKSWDSYYSKALGRPTTLCETMGKAEIWLIRTYWDFEFPRPYLP
NFEFVGGLHCKPAKPLPKEMEEFIQSSGKDGVVVFSLGSMVKNLTEEKANLIASALAQIP
QKVLWRYKGKKPATLGNNTQLFDWIPQNDLLGHPKTKAFITHGGTNGIYEAIYHGVPMVG
VPMFADQPDNIAHMKAKGAAVEVNLNTMTSVDLLSALRTVINEPSYKENAMRLSRIHHDQ
PVKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWFQYHSLDVIGFLLVCVTMAIFLVIQCC
LFSCQKFGKIGKKKKRE
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatgagtgctgttcctccaggaaacttcagcagagaaaaacatttgcttcacat
ctcatcaaatcttctgcatcaagccacatcatgttaaataaccttctgctgttctccctt
cagataagtctcataggaaccactcttggtgggaatgttttgatttggccaatggaaggt
agtcattggctaaatgttaagataattatagatgagctcattaaaaaggagcataatgtg
actgtcctagttgcctctggtgcacttttcatcacaccaacctctaacccatctctgaca
tttgaaatatataaggtgccctttggcaaagaaagaatagaaggagtaattaaggacttc
gttttgacatggctggaaaatagaccatctccttcaaccatttggagattctatcaggag
atggccaaagtaatcaaggacttccacatggtgtctcaggagatctgtgatggcgttctt
aaaaaccaacagctgatggaaaagctaaagaaaagcaagtttgaagtcctggtgtctgat
ccagtatttccttgtggcgatatagtagctttaaaacttggaattccatttatgtactcc
ttgaggttttctccagcctcaacagtggaaaagcactgtgggaaggtaccataccctcct
tcctatgttcctgctgttttatcagaactcaccgaccaaatgtctttcactgacagaata
agaaatttcatctcctaccacctacaggactacatgtttgaaactctttggaaatcatgg
gattcatactatagtaaagctttaggaagacccactacgttatgtgagactatggggaaa
gctgaaatttggttaatccgaacatattgggattttgaatttcctcgtccatacttacct
aattttgagtttgttggaggattgcactgcaaacctgccaaacctttacctaaggaaatg
gaagaatttatccagagctcaggtaaagatggtgttgtggtgttttctctgggatcaatg
gtcaaaaaccttacagaagaaaaggccaatcttattgcctcagcccttgcccagattcca
cagaaggttttatggagatacaaaggaaagaaaccagccacattaggaaacaatactcag
ctctttgattggataccccagaatgatcttcttggacatcccaaaaccaaagcttttatc
actcatggtggaactaatgggatctacgaagctatttaccacggagtccctatggtggga
gttcccatgtttgctgatcagcctgataacattgctcacatgaaggccaaaggagcagct
gtggaagtgaacctaaacacaatgacaagtgtggatttgcttagcgctttgagaacagtc
attaatgaaccttcttataaagagaatgctatgaggttatcaagaattcaccatgatcaa
cctgtaaagcccctggatcgagcagtcttctggatcgagtttgtcatgcgccacaaagga
gccaagcaccttcgggttgcagcccacaacctcacctggttccagtaccactctttggat
gtaattgggttcttgctggtctgtgtgacaatggctatatttttggtcatacaatgttgt
ttgttttcctgtcaaaaatttggtaagataggaaagaagaaaaaaagagaatag

DBGET integrated database retrieval system