KEGG   Pan paniscus (bonobo): 100974246Help
Entry
100974246         CDS       T02283                                 

Gene name
ADRA2B
Definition
adrenoceptor alpha 2B
Orthology
K04139  
adrenergic receptor alpha-2B
Organism
pps  Pan paniscus (bonobo)
Pathway
cGMP-PKG signaling pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    100974246 (ADRA2B)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100974246 (ADRA2B)
G protein-coupled receptors [BR:pps04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [OT]
    100974246 (ADRA2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 448 aa AA seqDB search
MDHQDPYSVQATAAIAAAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADIL
VATLIIPFSLANELLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEY
NSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILASSIGS
FFAPCLIMILVYLRIYLIAKRSNRRGPRAKGGPGQGESKQPRPDHGGALASAKLPALASL
ASAREVNGHSKSTGEKEEGETPEDTGTRALPPSWAALPNSGQGQKEGVCGASPEDEAEEE
EEEEEEECEPQAVPVSPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRRRAQ
LTREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPKHCKVPHGLFQFFFWIGYCNSSLN
PVIYTIFNQDFRRAFRRILCRPWTQTAW
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggaccaccaggacccctactccgtgcaggccacggcggccatagcggcggccatcacc
ttcctcattctctttaccatcttcggcaacgctctggtcatcctggctgtgttgaccagc
cgctcgctgcgcgcccctcagaacctgttcctggtgtcgctggccgccgccgacatcctg
gtggccacgctcatcatccctttctcgctggccaacgagctgctgggctactggtacttc
cggcgcacgtggtgcgaggtgtacctggcgctcgacgtgctcttctgcacctcgtccatc
gtgcacctgtgcgccatcagcctggaccgctactgggccgtgagccgcgcgctggagtac
aactctaagcgcaccccgcgccgcatcaagtgcatcatcctcactgtgtggctcatcgcc
gccgtcatctcgctgccgcccctcatctacaagggcgaccagggcccccagccgcgcggg
cgcccccagtgcaagctcaaccaggaggcctggtacatcctggcctccagcatcggatct
ttctttgctccttgcctcatcatgatccttgtctacctgcgcatctacctgatcgccaaa
cgcagcaaccgcagaggtcccagggccaagggggggcctgggcagggtgagtccaagcag
ccccgacccgaccatggtggggctttggcctcagccaaactgccagccctggcctctctg
gcttctgccagagaggtcaacggacactcgaagtccactggggagaaggaggagggggag
acccctgaagatactgggacccgggccttgccacccagttgggctgcccttcccaactca
ggccagggccagaaggagggtgtttgtggggcatctccagaggatgaagctgaagaggag
gaagaggaggaggaggaagagtgtgaaccccaggcagtgccagtgtctccggcctcagct
tgcagccccccgctgcagcagccacagggctcccgggtgctggccaccctacgtggccag
gtgctcctgggcaggggcgtgggtgctataggtgggcagtggtggcgtcgacgggcgcag
ctgacccgggagaagcgcttcaccttcgtgctggctgtggtcattggcgtttttgtgctc
tgctggttccccttcttcttcagctacagcctgggcgccatctgcccgaagcactgcaag
gtgccccatggcctcttccagttcttcttctggatcggctactgcaacagctcactgaac
cctgttatctacaccatcttcaaccaggacttccgccgtgccttccggaggatcctgtgc
cgcccttggacccagacggcctggtga

DBGET integrated database retrieval system