KEGG   Pan paniscus (bonobo): 100974387Help
Entry
100974387         CDS       T02283                                 

Definition
UDP-glucuronosyltransferase 2B4-like
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
pps  Pan paniscus (bonobo)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100974387
   00053 Ascorbate and aldarate metabolism
    100974387
   00500 Starch and sucrose metabolism
    100974387
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100974387
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100974387
   00860 Porphyrin and chlorophyll metabolism
    100974387
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100974387
   00982 Drug metabolism - cytochrome P450
    100974387
   00983 Drug metabolism - other enzymes
    100974387
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100974387
Enzymes [BR:pps01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100974387
Glycosyltransferases [BR:pps01003]
 Others
  Hydrophobic molecule
   100974387
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 528 aa AA seqDB search
MSMKWTSALLLIQLSCYFSSGSCGKVLVWPTEFSHWMNIKTILDELVQRGHEVTVLASSA
SISFDPSSPSTLKFEVYPVSLTKTEFEDIIKQLVKRWAELPKDTFWSYFSQVQEIMWTFS
DILRKFCKDIVSNKKLMKKLQESRFDVVLADAVFPFGELLAELLKIPFVYSLRFSPGYAI
EKHSGGLLFPPSYVPVVMSELSDQMTFIERVKNIIYVLYFEFWFQIFDMKKWDQFYSEVL
GRPTTLSETMAKADIWLIRNYWDFQFPHPLLPNVEFVGGLHCKPAKPLPKEMEEFVQSSG
ENGVVVFSLGSMVSNTSEERANVIASALAKIPQKVLWRFDGNKPDTLGLNTRLYKWIPQN
DLLGHPKTRAFITHGGANGIYEAIYHGIPMVGVPLFADQPDNIAHMKAKGAAVSLDFHTM
SSTDLLNALKTVINDPLYKENAMKLSRIHHDQLVKPLDRAVFWIEFVMRHKGAKHLRVAA
HDLTWFQYHSLDVIGFLLACVATVIFIITKCLFCVWKFARTAKKGKRD
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgaaatggacttcagctcttctgctgatacagctgagctgttactttagctct
gggagttgtggaaaggtgctggtgtggcccacagaattcagccactggatgaatataaag
acaatcctggatgaacttgtccagagaggtcatgaggtgactgtattggcatcttcagct
tccatttcttttgatcccagcagcccatctactcttaaatttgaagtttatcctgtatct
ttaactaaaactgagtttgaggatattatcaagcagctggttaagagatgggcagaactt
ccaaaagacacattttggtcatatttttcacaagtacaggaaatcatgtggacatttagt
gacatacttagaaagttctgtaaggatatagtttcaaataagaaacttatgaagaaacta
caggagtcaagatttgatgttgttcttgcagatgctgttttcccctttggtgagctgctg
gccgagttacttaaaataccctttgtctacagcctccgcttctctcctggctacgcaatt
gaaaagcatagtggaggacttctgttccctccttcctatgtgcctgttgttatgtcagaa
ctaagtgaccaaatgactttcatagagagggtaaaaaatattatctatgtgctttatttt
gaattttggttccaaatatttgacatgaagaagtgggatcagttctacagtgaagttcta
ggaagacccactacgttatctgagacaatggcaaaagctgacatatggcttattcgaaac
tactgggattttcaatttcctcacccactcttaccaaatgttgagttcgttggaggactc
cactgcaaacctgccaaacccctaccgaaggaaatggaagagtttgtccagagctctgga
gaaaatggtgttgtggtgttttctctggggtcgatggtcagtaacacgtcagaagaaagg
gccaatgtaattgcatcagcccttgccaagatcccacaaaaggttctgtggagatttgat
gggaataaaccagatactttaggactcaatactcggctgtacaagtggataccccagaat
gatcttcttggtcacccaaaaaccagagcttttataactcatggtggagccaatggcatc
tatgaggcgatctaccatggaatccctatggtgggcgttccattgtttgcagatcaacct
gataacattgcacacatgaaggccaagggagcagctgttagtttggacttccacacaatg
tcgagtacagacttactcaatgcactgaagacagtaattaatgatcctttatataaagag
aatgctatgaaattatcaagaattcatcatgatcaactagtgaagccccttgatcgagca
gtcttctggattgaatttgtcatgcgccataaaggagccaagcaccttcgggttgcagcc
cacgacctcacctggttccagtaccactctttggatgtgattgggttcctgctggcctgt
gtggcaactgtgatattcatcatcacaaaatgtctgttttgtgtctggaagtttgctaga
acagcaaagaaggggaaaagagattaa

DBGET integrated database retrieval system