KEGG   Pan paniscus (bonobo): 100974672Help
Entry
100974672         CDS       T02283                                 

Gene name
CREB1
Definition
cAMP responsive element binding protein 1
Orthology
K05870  
cyclic AMP-responsive element-binding protein 1
Organism
pps  Pan paniscus (bonobo)
Pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Adrenergic signaling in cardiomyocytes
Osteoclast differentiation
Antigen processing and presentation
TNF signaling pathway
Circadian rhythm
Circadian entrainment
Cholinergic synapse
Dopaminergic synapse
Insulin secretion
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Vasopressin-regulated water reabsorption
Huntington's disease
Cocaine addiction
Amphetamine addiction
Alcoholism
Tuberculosis
Hepatitis B
HTLV-I infection
Viral carcinogenesis
Prostate cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    100974672 (CREB1)
   04024 cAMP signaling pathway
    100974672 (CREB1)
   04022 cGMP - PKG signaling pathway
    100974672 (CREB1)
   04151 PI3K-Akt signaling pathway
    100974672 (CREB1)
   04152 AMPK signaling pathway
    100974672 (CREB1)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    100974672 (CREB1)
  Endocrine system
   04911 Insulin secretion
    100974672 (CREB1)
   04915 Estrogen signaling pathway
    100974672 (CREB1)
   04918 Thyroid hormone synthesis
    100974672 (CREB1)
   04916 Melanogenesis
    100974672 (CREB1)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100974672 (CREB1)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    100974672 (CREB1)
  Nervous system
   04725 Cholinergic synapse
    100974672 (CREB1)
   04728 Dopaminergic synapse
    100974672 (CREB1)
  Development
   04380 Osteoclast differentiation
    100974672 (CREB1)
  Environmental adaptation
   04710 Circadian rhythm
    100974672 (CREB1)
   04713 Circadian entrainment
    100974672 (CREB1)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100974672 (CREB1)
   05215 Prostate cancer
    100974672 (CREB1)
  Neurodegenerative diseases
   05016 Huntington's disease
    100974672 (CREB1)
  Substance dependence
   05030 Cocaine addiction
    100974672 (CREB1)
   05031 Amphetamine addiction
    100974672 (CREB1)
   05034 Alcoholism
    100974672 (CREB1)
  Infectious diseases
   05152 Tuberculosis
    100974672 (CREB1)
   05166 HTLV-I infection
    100974672 (CREB1)
   05161 Hepatitis B
    100974672 (CREB1)
Transcription factors [BR:pps03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   CREB
    100974672 (CREB1)
Mitochondrial biogenesis [BR:pps03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    100974672 (CREB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 327 aa AA seqDB search
MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSY
RKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLA
NNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQI
RTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENR
VAVLENQNKTLIEELKALKDLYCHKSD
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggaatctggagccgagaaccagcagagtggagatgcagctgtaacagaagct
gaaaaccaacaaatgacagttcaagcccagccacagattgccacattagcccaggtatct
atgccagcagctcatgcaacatcatctgctcccaccgtaactctagtacagctgcccaat
gggcagacagttcaagtccatggagtcattcaggcggcccagccatcagttattcagtct
ccacaagtccaaacagttcagatttcaactattgcagaaagtgaagattcacaggagtca
gtggatagtgtaactgattcccaaaagcgaagggaaattctttcaaggaggccttcctac
aggaaaattttgaatgacttatcttctgatgcaccaggagtgccaaggattgaagaagag
aagtctgaagaggagacttcagcacctgccatcaccactgtaacggtgccaactccaatt
taccaaactagcagtggacagtatattgccattacccagggaggagcaatacagctggct
aacaatggtaccgatggggtacagggcctgcaaacattaaccatgaccaatgcagctgcc
actcagccgggtactaccattctacagtatgcacagaccactgatggacagcagatctta
gtgcccagcaaccaagttgttgttcaagctgcctctggagacgtacaaacataccagatt
cgcacagcacccactagcactattgcccctggagttgttatggcatcctccccagcactt
cctacacagcctgctgaagaagcagcacgaaagagagaggtccgtctaatgaagaacagg
gaagcagctcgagagtgtcgtagaaagaagaaagaatatgtgaaatgtttagaaaacaga
gtggcagtgcttgaaaatcaaaacaagacattgattgaggagctaaaagcacttaaggac
ctttactgccacaaatcagattaa

DBGET integrated database retrieval system