KEGG   Pan paniscus (bonobo): 100974702Help
Entry
100974702         CDS       T02283                                 

Gene name
EEF2K
Definition
eukaryotic elongation factor-2 kinase
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
pps  Pan paniscus (bonobo)
Pathway
Oxytocin signaling pathway
Class
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:pps04921]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 723 aa AA seqDB search
MADEDLIFRLEGVDGGQSPRAGHDGDSDGDSDDEEGYFICPITDDPSSNQNVNSKVNKYY
SNLTKSERYSSSGSPANSFHFKEAWKHAIQKAKHMPDPWAEFHLEDIATERATRHRVPFG
WGMGTDNTLCGVFQPFGRGAMRECFRTKKLSNFLHAQQWKGASNYVAKRYIEPVDRDVYF
EDVRLQMEAKLWGEEYNRHKPPKQVDIMQMCIIELKDRPGKPLFHLEHYIEGKYIKYNSN
SGFVRDDNIRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDPQIHTETGTDFGDGNLGV
RGMALFFYSHACNRICESMGLAPFDLSPRERDAVNQNTKLLQSAKTILRGTEEKCGSPRV
RTLSGSRPPLLRPLSENSGDENMSDVTFDSLPSSPSSATPHSQKLDHLHWPVFSDLDNMA
SRDHDHLDNHRESENSGDSGYPSEKRGELDDPEPREHGHSYSNRKYESDEDSLGSSGRVC
VEKWNLLNSSRLHLPRASAVALEVQRLNALDLEKKIGKSILGKVHLAMVRYHEGGRFCEK
GEEWDQESAVFHLEHAADLGELEAIVGLGLMYSQLPHHILADVSLKETEENKTKGFDYLL
KAAEAGDRQSMILVARAFDTGQNLSPDRCQDWLEALHWYNTALEMTDCDEGGEYDGMQNE
PRYMMLAREAEMLFTGGYGLEKDPQRSGDLYTQAAEAAMEAMKGRLANQYYQKAEEAWAQ
MEE
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgaagatctcatcttccgcctggaaggcgttgatggcggccagtccccccga
gctggccatgatggtgattctgatggggacagcgacgatgaggaaggttacttcatctgc
cccatcacggatgacccaagctcaaaccagaatgtcaattccaaggttaataagtactac
agcaacctaacaaaaagtgagcggtatagctccagcgggtccccggcaaactccttccac
ttcaaggaagcctggaagcacgcaatccagaaggccaagcacatgcccgacccctgggct
gagttccacctggaagatattgccaccgaacgtgctactcgacacagggtcccttttggg
tggggcatggggactgataacactctgtgtggtgtctttcagcccttcggccgaggagca
atgagggagtgcttccggacgaagaagctctccaacttcttgcatgcccagcagtggaag
ggagcctccaactacgtggcgaagcgctacatcgagcccgtagaccgggatgtgtacttt
gaggacgtgcgtctacagatggaggccaagctctggggggaggagtataatcggcacaag
ccccccaagcaggtggacatcatgcaaatgtgcatcatcgagctgaaggacagaccgggc
aagcccctcttccacctggagcactacatcgagggcaagtacatcaagtacaactccaac
tctggctttgtccgcgatgacaacatccgcctgacgccgcaggccttcagccacttcact
tttgagcgttccggccatcagctgatagtggtggacatccagggagttggggatctctac
actgacccacagatccacacggagacgggcactgactttggagacggcaacctaggtgtc
cgcgggatggcgctcttcttctactctcatgcctgcaaccggatttgcgagagcatgggc
cttgctccctttgacctctcgccccgggagagggatgcggtgaatcagaacaccaagctg
ctgcaatcagccaagaccatcttgagaggaacagaggaaaaatgtgggagcccccgagta
aggaccctctctgggagccggccacccctgctccgtcccctttcagagaactctggagac
gagaacatgagcgacgtgaccttcgactctctcccttcttccccatcttcggccacacca
cacagccagaagctagaccacctccattggccagtgttcagtgaccttgataacatggca
tccagagaccatgatcatctagacaaccaccgggagtctgagaatagtggggacagcgga
taccccagtgagaagcggggtgagctggatgaccctgagccccgagaacatggccactca
tacagtaatcggaagtacgagtctgacgaagacagcctgggcagctctggacgggtatgt
gtagagaagtggaatctcctcaactcctcccgcctccacctgccgagggcttcggccgtg
gccctggaagtgcaaaggcttaatgctctggacctcgaaaagaaaatcgggaagtccatt
ttggggaaggtccatctggccatggtgcgctaccacgagggtgggcgcttctgcgagaag
ggcgaggagtgggaccaggagtcggctgtcttccacctggagcacgcagccgacctgggc
gagctggaggccatcgtgggcctgggactcatgtactcgcagttgcctcatcacatccta
gccgatgtctctctgaaggagacagaagagaacaaaaccaaaggatttgattacttacta
aaggccgctgaagctggcgacaggcagtccatgatcctagtggcgcgagcttttgacact
ggccagaacctcagcccagacaggtgccaagactggctagaggccctgcactggtacaac
actgccctggagatgacggactgtgatgagggcggtgagtacgatggaatgcagaacgag
ccccggtacatgatgctggccagggaggccgagatgctgttcacaggaggctacgggctg
gagaaggacccacagagatcaggggacttgtatacccaggcagcagaggcagcgatggaa
gccatgaagggccgactggccaaccagtactaccaaaaggctgaagaggcctgggcccag
atggaggagtaa

DBGET integrated database retrieval system