KEGG   Pan paniscus (bonobo): 100974753Help
Entry
100974753         CDS       T02283                                 

Gene name
NUP205
Definition
(RefSeq) nucleoporin 205
  KO
K14310  nuclear pore complex protein Nup205
Organism
pps  Pan paniscus (bonobo)
Pathway
pps03013  RNA transport
Module
pps_M00427  Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:pps00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100974753 (NUP205)
Messenger RNA biogenesis [BR:pps03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100974753 (NUP205)
Chromosome and associated proteins [BR:pps03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    100974753 (NUP205)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nup192
Motif
Other DBs
NCBI-GeneID: 100974753
NCBI-ProteinID: XP_014201312
Position
7
AA seq 1844 aa AA seqDB search
MTTRFTDELMEQGLTYKVLTLVSQIDVNNEFEKLQRERGLGSEKHRKEVSDLIKECRQSL
AESLFAWACQSPLGKEDTLLLIGHLERVTVEANGSLDAVNLALLMALLYCFDISFIEQST
EERDDMIHQLPLLTEKQYIATIHSRLQDSQLWKLPGLQATVRLAWALALRGISQLPDVTA
LAEFTEADEAMAELAIADNVFLFLTESVVVSEYFYQEEFYIRRVHNLITDFLALMPMKVK
QLRNRADEDARMIHMSMQMGNEPPISLRRDLEHLMLLIGELYKKNPFHLELALEYWCPTE
PLQTPTIMGSYLGVAHQRPPQRQVVLSKFVRQMGDLLPPTIYIPYLKMLQGLANGPQCAH
YCFSLLKVNGSSHVENIQGAGGSPVSWEHFFHSLMLYHEHLRKDLPSADSVQYRHLPSRG
ITQKEQDGLIAFLQLTSTIITWSENARLALCEHPQWTPVVVTLGLLQCSIPPVLKAELLK
TLAAFGKSPEIAASLWQSLEYTQILQTVRIPSQRQAIGIEVELNEIESRCEEYPLTRAFC
QLISTLVESSFPSNLGAGLRPPGFDPYLQFLRDSVFLRFRTRAYRRAAEKWEVAEVVLEV
FYKLLRDYEPQLEDFIDQFVELQGEEIIAYKPPGFSLMYHLLNESPMLELALSLLEEGVK
QLDTYAPFPGKKHLEKAVQHCLALLNLTLQKENLFMDLLRESQLALIVCPLEQLLQGINP
RTKKADNVVNIARYLYHGNTNPELAFESAKILCCISCNSNIQIKLVGDFTHDQSISQKLM
AGFVECLDCEDAEEFVRLEEGSELEKKLVAIRHETRIHILNLLITSLECNPPNLALYLLG
FELKKPVSTTNLQDPGVLGCPRTCLHAILNILEKGTEGRTGPVAVRESPQLAELCYQVIY
QLCACSDTSGPTMRYLRTSQDFLFSQLQYLPFSNKEYEISMLNQMSWLMKTASIELRVTS
LNRQRSHTQRLLHLLLDDMPVKPYSDGEGGIEDENRSVSGFLHFDTATKVRRKILNILDS
IDFSQEIPEPLQLDFFDRAQIEQVIANCEHKNLRGQTVCNVKLLHRVLVAEVNALQGMAA
IGQRPLLMEEISTVLQYVVGRNKLLQCLHAKRHALESWRQLVEIILTACPQDLIQAEDRQ
LIIRDILQDVHDKILDDEAAQELMPVVAGAVFTLTAHLSQAVLTEQKQTSVLGPAEAHYA
FMLDSCFTSPPPEENPLVGFASIGDSSLYIILKKLLNFILKTGGGFQRVRTHLYGSLLYY
LQIAQRPDEPDTLEAAKKTMWERLTAPEDVFSKLQRENIAIIESYGAALMEVVCRDACDG
HEIGRMLALALLDRIVSVDKQQQWLLYLSNSGYLKVLVDSLVEDDRTLQSLLTPQPPLLK
ALYTYESKMAFLTRVAKIQQGALELLRSGVIVRLAQCQVYDMRPETDPQSMFGMRDPPMF
IPTPVDRYRQILLPALQLCQVILTSSMAQHLQAAGQVLQFLISHSDTIQAILRCQDVSAG
SLQELALLTGIISKAALPGILSELDVDVNEGSLMELQGHIGRFQRQCLGLLSRFGGSDRL
RQFKFQDDNVEGDKVSKKDEIELAMQQICANVMEYCQSLMLQSSSTFQHAVCLFTPSLSE
TVNRDGPRQDTQAPVVPYWRLPGLGIIIYLLKQSANDFFSYYDSHRQSVSKLQNVEQLPP
DEIKELCQSVMPAGVDKISTAQKYVLARRRLVKVINNRAKLLSLCSFIIETCLFILWRHL
EYYLLHCMATDSQDSLFASRTLFKSRRLQDSFASETNLDFRSGLAIVSQHDLDQLQADAI
NAFGESLQKKLLDIEGLYSKVRSRYSFIQALVRRIRGLLRISRN
NT seq 5535 nt NT seq  +upstreamnt  +downstreamnt
atgacaacacgctttacagatgagctgatggagcaaggattgacttataaagttcttacc
ctggtgtcacagattgatgtgaataatgagtttgagaaactacagcgagagagaggtttg
ggcagtgaaaaacatcgcaaagaggtttctgatctcattaaggagtgcaggcagtctctt
gcagaaagcctttttgcctgggcttgccagtcacctttaggcaaagaagacactctcctc
ctcattggacatttggaaagagtgacagttgaggctaatggctcactggatgcagtgaat
ctggctcttcttatggcgcttctgtactgttttgatatcagttttatagagcaaagcaca
gaggaacgagatgatatgattcatcaacttccactgttgacagaaaaacagtacattgca
acaattcactctcgtcttcaggactcacagctttggaaactgcctgggctccaagccact
gttagacttgcctgggcgctggcattgaggggaatatcccagctacccgatgtgacagct
ctggcagaattcacagaggcagatgaagcaatggcagaactcgcaattgctgacaacgtt
ttcctgttcctcacggaatctgtagtggtatcagaatacttttatcaggaagaattttat
attcgcagagtccataatctcatcacagattttcttgcacttatgccaatgaaggtgaaa
cagctgaggaatcgggcagatgaagatgctcgaatgattcacatgagtatgcagatgggt
aatgaaccccccatttcacttagaagggacctggaacacttaatgcttttgattggcgag
ctatataaaaagaacccttttcatctggagcttgctctagaatattggtgtcccacagag
cctcttcagactccaactatcatgggctcttatctaggggtggctcatcagcggccccct
caacgccaggttgtcttgtcaaagtttgttaggcaaatgggtgacctgttgcctccaact
atttatattccttatttgaagatgctccagggattggccaatgggcctcagtgtgcccac
tactgtttcagcctgctcaaagtcaatggtagtagtcatgttgaaaatattcagggagca
ggtggcagtcctgtttcctgggaacatttctttcactccttgatgctttaccacgaacac
cttcggaaggatcttccaagtgcagatagcgtccagtaccgtcaccttccttcccgtggc
atcacccagaaggagcaagatggattgattgcttttttgcagctcacgtctaccatcatt
acttggagtgaaaatgctcgcttggcactctgtgaacaccctcagtggacccctgttgtg
gtgactctgggactcctccaatgcagtattccccctgtcctaaaagctgagctactgaag
acactcgcagcttttggaaaatctcctgaaattgctgcttccctctggcagtcattggaa
tacactcagatactgcagaccgtgaggattccaagccaaaggcaagctattggtattgag
gttgaactaaatgaaatagaatcccggtgtgaagaatacccattgactcgggccttttgc
cagcttattagtaccctggtggagagctcatttccttctaatttgggtgctggactgcgg
ccccctggctttgacccttatttgcagttccttagagactctgtgtttctacgattccgt
acgagagcttaccggagagcagctgaaaagtgggaagttgctgaggtggttttggaggtg
ttttataaattgctcagagattacgagcctcagcttgaagattttatagaccagtttgtg
gaactacaaggagaagaaatcatagcctataagccacctggatttagtctgatgtatcat
ctgctgaatgagtcaccaatgttggagcttgctctcagtttactggaagaaggagttaag
cagcttgacacctatgccccctttcctgggaaaaaacacctggagaaagcagtacagcat
tgccttgcacttctcaatcttactctgcagaaggaaaatctttttatggaccttctaaga
gagagtcaactggctctaatagtctgtcctttagaacagcttttgcagggaattaatccc
agaactaagaaggcagataatgtggtaaacattgccagatacctatatcatggcaatact
aatccagaactggcttttgaaagtgccaagatcctctgttgtatctcttgcaactctaat
attcagataaagttggttggagatttcacacatgaccagagtataagtcagaaactaatg
gctggatttgtggagtgtttggattgtgaagatgcagaagaatttgtacgtctggaagag
ggatcagaacttgaaaagaaattagttgcaattcgtcatgaaacaagaatccacatcttg
aatcttctcattacctctctggaatgcaatccacccaatcttgctctctacctgttgggc
tttgaattgaaaaaacctgtcagtactacaaacctacaagatccaggagtgttaggttgc
cctcggacatgccttcacgccattctaaacatcttggagaaaggaacggaagggagaaca
ggcccagtggcagtgcgagaatctcctcaactggctgagctatgttaccaggtcatatat
cagttatgtgcatgctctgatacatctggtcctactatgaggtacttgagaaccagccag
gatttcttattttcccagttgcagtatctaccattttctaacaaagaatatgaaatatct
atgctgaaccagatgtcatggcttatgaaaactgcctcaatagagctaagggtaacctct
ctgaatcgtcagcggtcgcatacccagaggctcctacacctcttactggatgacatgcca
gtgaaaccatactcagatggtgaaggaggaatagaagatgaaaacaggtctgtttctggg
ttccttcactttgacactgctacaaaagtacgtcgaaaaattctaaatattcttgactcg
attgacttcagtcaggagatccctgagcctttgcagttggatttttttgatcgggcccag
attgaacaagttattgctaactgtgaacacaagaatttacggggacagacagtctgcaat
gtcaagcttcttcatagggttcttgtagctgaagtaaatgcccttcagggtatggcagcc
ataggacagagacctctactaatggaggaaatcagcactgtacttcagtatgtggtagga
agaaataaattgctgcagtgtcttcatgcaaaacgtcatgctctggagtcgtggaggcaa
ctggtagaaattatactgacagcttgtccccaggacctcattcaggcagaggatcgacaa
ctgattattcgtgatattttacaagatgtgcatgataagatactggatgatgaagctgcg
caagagttaatgcctgtggtcgccggggcagtgttcacactgactgctcacctaagccag
gccgtcctcactgaacagaagcaaacatcagtcttgggaccagcagaggcccattacgct
tttatgcttgatagttgcttcacctcacctcctcctgaagagaacccattagtgggtttt
gcttctattggagattcttcactttacatcatattgaagaaactgttaaacttcattttg
aagacaggtggtggattccaacgagtgaggactcacttgtatggctctctgctttattac
ttacagattgcccagagacctgatgaaccagacaccttagaagcagccaagaaaaccatg
tgggaaaggctgacagcccctgaagatgtatttagcaaattacagcgagaaaacatagcc
attattgaaagttatggcgccgccctcatggaagtggtctgtcgagatgcttgtgatggt
catgagattggaaggatgctggccctggctctacttgatagaattgtctccgtggataaa
cagcagcagtggcttttgtatctttctaacagtggctacttgaaggtcctcgtagacagc
ttggtagaagatgaccgtactttgcagagcttactcaccccacagcctccccttttaaaa
gcactttatacttatgaatctaaaatggcatttctcacaagagtggcaaagatacagcag
ggtgcattagagctgctaagatcaggggtgattgtgagactagctcaatgccaagtctat
gacatgcgcccagaaacggacccgcagagcatgtttggcatgagagaccctccaatgttc
atccctaccccagtggatcgctaccgccagattctcctcccagctctccagctgtgccag
gtcatcctcacatctagtatggcccagcacttgcaggcagcagggcaggtattgcagttt
cttatttcacattctgataccatacaagcaattctgcgctgtcaggatgttagtgctggg
tctttgcaggaattggctctgctgacaggaattataagtaaagcagcacttcctgggata
ttaagtgaacttgacgttgatgtaaatgaagggtctctaatggagctacagggacatatt
ggaagattccagcgccagtgcttaggactactaagtcgctttggtggctctgacagactg
cgtcagtttaaatttcaagacgataatgtggagggagataaagtaagcaagaaagatgag
attgaactggctatgcagcagatttgtgccaatgtaatggaatattgccagtcactcatg
ttacagagttcctctaccttccagcatgctgtgtgtctcttcactcctagcctttcagaa
acagttaatagagatggaccgcggcaagatacccaagctccagtggttccatactggcgc
ctgcctggtttaggcattatcatctacctgctgaaacagagtgctaatgatttcttcagc
tattatgacagtcatcgacagagtgtcagcaagctacaaaatgtagagcagcttccccca
gatgagataaaagagttgtgtcagtctgtgatgcctgctggtgttgataaaatctccact
gcccagaaatatgttctagcaagacggcgcttggtgaaggtgatcaacaatcgagctaaa
ctgctttccctttgttcttttatcatagagacctgcctatttattctttggcgccatctg
gagtactacttgttacattgcatggccacggattctcaagattccttatttgcctcgaga
accttgtttaaaagcagaagactgcaagattccttcgcctcagaaaccaatctagatttt
agaagtgggctggctatagtgagccaacatgatttagaccagcttcaggctgatgcaatc
aacgcttttggagaatcactacaaaagaaacttctggacattgaaggattatattcaaaa
gttcgatctcgatatagtttcatacaggctcttgtcagacgtatccgtggcctcttgagg
atatcaaggaactga

DBGET integrated database retrieval system