KEGG   Pan paniscus (bonobo): 100974753Help
Entry
100974753         CDS       T02283                                 

Gene name
NUP205
Definition
nucleoporin 205kDa
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
pps  Pan paniscus (bonobo)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:pps00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100974753 (NUP205)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1975 aa AA seqDB search
MATPLAVNSDQSLAVTVIEKPKNVQQHEKVQKASTEGVAIQGQQGTRLLPEQLIKEAFIL
SDLFDIGELAAVELLLAGEHQQPHFPGLTRGLVAVLLYWDGKRCIANSLKALIQSRRGKT
WTLELSPELASMTTRFTDELMEQGLTYKVLTLVSQIDVNNEFEKLQRERGLGSEKHRKEV
SDLIKECRQSLAESLFAWACQSPLGKEDTLLLIGHLERVTVEANGSLDAVNLALLMALLY
CFDISFIEQSTEERDDMIHQLPLLTEKQYIATIHSRLQDSQLWKLPGLQATVRLAWALAL
RGISQLPDVTALAEFTEADEAMAELAIADNVFLFLTESVVVSEYFYQEEFYIRRVHNLIT
DFLALMPMKVKQLRNRADEDARMIHMSMQMGNEPPISLRRDLEHLMLLIGELYKKNPFHL
ELALEYWCPTEPLQTPTIMGSYLGVAHQRPPQRQVVLSKFVRQMGDLLPPTIYIPYLKML
QGLANGPQCAHYCFSLLKVNGSSHVENIQGAGGSPVSWEHFFHSLMLYHEHLRKDLPSAD
SVQYRHLPSRGITQKEQDGLIAFLQLTSTIITWSENARLALCEHPQWTPVVVTLGLLQCS
IPPVLKAELLKTLAAFGKSPEIAASLWQSLEYTQILQTVRIPSQRQAIGIEVELNEIESR
CEEYPLTRAFCQLISTLVESSFPSNLGAGLRPPGFDPYLQFLRDSVFLRFRTRAYRRAAE
KWEVAEVVLEVFYKLLRDYEPQLEDFIDQFVELQGEEIIAYKPPGFSLMYHLLNESPMLE
LALSLLEEGVKQLDTYAPFPGKKHLEKAVQHCLALLNLTLQKENLFMDLLRESQLALIVC
PLEQLLQGINPRTKKADNVVNIARYLYHGNTNPELAFESAKILCCISCNSNIQIKLVGDF
THDQSISQKLMAGFVECLDCEDAEEFVRLEEGSELEKKLVAIRHETRIHILNLLITSLEC
NPPNLALYLLGFELKKPVSTTNLQDPGVLGCPRTCLHAILNILEKGTEGRTGPVAVRESP
QLAELCYQVIYQLCACSDTSGPTMRYLRTSQDFLFSQLQYLPFSNKEYEISMLNQMSWLM
KTASIELRVTSLNRQRSHTQRLLHLLLDDMPVKPYSDGEGGIEDENRSVSGFLHFDTATK
VRRKILNILDSIDFSQEIPEPLQLDFFDRAQIEQVIANCEHKNLRGQTVCNVKLLHRVLV
AEVNALQGMAAIGQRPLLMEEISTVLQYVVGRNKLLQCLHAKRHALESWRQLVEIILTAC
PQDLIQAEDRQLIIRDILQDVHDKILDDEAAQELMPVVAGAVFTLTAHLSQAVLTEQKQT
SVLGPAEAHYAFMLDSCFTSPPPEENPLVGFASIGDSSLYIILKKLLNFILKTGGGFQRV
RTHLYGSLLYYLQIAQRPDEPDTLEAAKKTMWERLTAPEDVFSKLQRENIAIIESYGAAL
MEVVCRDACDGHEIGRMLALALLDRIVSVDKQQQWLLYLSNSGYLKVLVDSLVEDDRTLQ
SLLTPQPPLLKALYTYESKMAFLTRVAKIQQGALELLRSGVIVRLAQCQVYDMRPETDPQ
SMFGMRDPPMFIPTPVDRYRQILLPALQLCQVILTSSMAQHLQAAGQVLQFLISHSDTIQ
AILRCQDVSAGSLQELALLTGIISKAALPGILSELDVDVNEGSLMELQGHIGRFQRQCLG
LLSRFGGSDRLRQFKFQDDNVEGDKVSKKDEIELAMQQICANVMEYCQSLMLQSSSTFQH
AVCLFTPSLSETVNRDGPRQDTQAPVVPYWRLPGLGIIIYLLKQSANDFFSYYDSHRQSV
SKLQNVEQLPPDEIKELCQSVMPAGVDKISTAQKYVLARRRLVKVINNRAKLLSLCSFII
ETCLFILWRHLEYYLLHCMATDSQDSLFASRTLFKSRRLQDSFASETNLDFRSGLAIVSQ
HDLDQLQADAINAFGESLQKKLLDIEGLYSKVRSRYSFIQALVRRIRGLLRISRN
NT seq 5928 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgcctttggcggtaaattcggatcagagtttagcagtcacagttattgagaag
ccaaaaaatgttcaacagcatgagaaggttcagaaagccagtacagagggagtcgccatt
cagggtcaacagggaactcgacttcttcctgaacagctcattaaagaagcctttattctc
agtgacctttttgatattggagaattggcagctgttgagcttcttcttgctggagagcat
caacagccacattttcctggccttaccagaggattagtagctgttcttttgtactgggat
ggaaagcgatgcattgcgaattccttgaaagccttgatacagtctagacggggaaagaca
tggacactagaactcagtcctgagctggcttccatgacaacacgctttacagatgagctg
atggagcaaggattgacttataaagttcttaccctggtgtcacagattgatgtgaataat
gagtttgagaaactacagcgagagagaggtttgggcagtgaaaaacatcgcaaagaggtt
tctgatctcattaaggagtgcaggcagtctcttgcagaaagcctttttgcctgggcttgc
cagtcacctttaggcaaagaagacactctcctcctcattggacatttggaaagagtgaca
gttgaggctaatggctcactggatgcagtgaatctggctcttcttatggcgcttctgtac
tgttttgatatcagttttatagagcaaagcacagaggaacgagatgatatgattcatcaa
cttccactgttgacagaaaaacagtacattgcaacaattcactctcgtcttcaggactca
cagctttggaaactgcctgggctccaagccactgttagacttgcctgggcgctggcattg
aggggaatatcccagctacccgatgtgacagctctggcagaattcacagaggcagatgaa
gcaatggcagaactcgcaattgctgacaacgttttcctgttcctcacggaatctgtagtg
gtatcagaatacttttatcaggaagaattttatattcgcagagtccataatctcatcaca
gattttcttgcacttatgccaatgaaggtgaaacagctgaggaatcgggcagatgaagat
gctcgaatgattcacatgagtatgcagatgggtaatgaaccccccatttcacttagaagg
gacctggaacacttaatgcttttgattggcgagctatataaaaagaacccttttcatctg
gagcttgctctagaatattggtgtcccacagagcctcttcagactccaactatcatgggc
tcttatctaggggtggctcatcagcggccccctcaacgccaggttgtcttgtcaaagttt
gttaggcaaatgggtgacctgttgcctccaactatttatattccttatttgaagatgctc
cagggattggccaatgggcctcagtgtgcccactactgtttcagcctgctcaaagtcaat
ggtagtagtcatgttgaaaatattcagggagcaggtggcagtcctgtttcctgggaacat
ttctttcactccttgatgctttaccacgaacaccttcggaaggatcttccaagtgcagat
agcgtccagtaccgtcaccttccttcccgtggcatcacccagaaggagcaagatggattg
attgcttttttgcagctcacgtctaccatcattacttggagtgaaaatgctcgcttggca
ctctgtgaacaccctcagtggacccctgttgtggtgactctgggactcctccaatgcagt
attccccctgtcctaaaagctgagctactgaagacactcgcagcttttggaaaatctcct
gaaattgctgcttccctctggcagtcattggaatacactcagatactgcagaccgtgagg
attccaagccaaaggcaagctattggtattgaggttgaactaaatgaaatagaatcccgg
tgtgaagaatacccattgactcgggccttttgccagcttattagtaccctggtggagagc
tcatttccttctaatttgggtgctggactgcggccccctggctttgacccttatttgcag
ttccttagagactctgtgtttctacgattccgtacgagagcttaccggagagcagctgaa
aagtgggaagttgctgaggtggttttggaggtgttttataaattgctcagagattacgag
cctcagcttgaagattttatagaccagtttgtggaactacaaggagaagaaatcatagcc
tataagccacctggatttagtctgatgtatcatctgctgaatgagtcaccaatgttggag
cttgctctcagtttactggaagaaggagttaagcagcttgacacctatgccccctttcct
gggaaaaaacacctggagaaagcagtacagcattgccttgcacttctcaatcttactctg
cagaaggaaaatctttttatggaccttctaagagagagtcaactggctctaatagtctgt
cctttagaacagcttttgcagggaattaatcccagaactaagaaggcagataatgtggta
aacattgccagatacctatatcatggcaatactaatccagaactggcttttgaaagtgcc
aagatcctctgttgtatctcttgcaactctaatattcagataaagttggttggagatttc
acacatgaccagagtataagtcagaaactaatggctggatttgtggagtgtttggattgt
gaagatgcagaagaatttgtacgtctggaagagggatcagaacttgaaaagaaattagtt
gcaattcgtcatgaaacaagaatccacatcttgaatcttctcattacctctctggaatgc
aatccacccaatcttgctctctacctgttgggctttgaattgaaaaaacctgtcagtact
acaaacctacaagatccaggagtgttaggttgccctcggacatgccttcacgccattcta
aacatcttggagaaaggaacggaagggagaacaggcccagtggcagtgcgagaatctcct
caactggctgagctatgttaccaggtcatatatcagttatgtgcatgctctgatacatct
ggtcctactatgaggtacttgagaaccagccaggatttcttattttcccagttgcagtat
ctaccattttctaacaaagaatatgaaatatctatgctgaaccagatgtcatggcttatg
aaaactgcctcaatagagctaagggtaacctctctgaatcgtcagcggtcgcatacccag
aggctcctacacctcttactggatgacatgccagtgaaaccatactcagatggtgaagga
ggaatagaagatgaaaacaggtctgtttctgggttccttcactttgacactgctacaaaa
gtacgtcgaaaaattctaaatattcttgactcgattgacttcagtcaggagatccctgag
cctttgcagttggatttttttgatcgggcccagattgaacaagttattgctaactgtgaa
cacaagaatttacggggacagacagtctgcaatgtcaagcttcttcatagggttcttgta
gctgaagtaaatgcccttcagggtatggcagccataggacagagacctctactaatggag
gaaatcagcactgtacttcagtatgtggtaggaagaaataaattgctgcagtgtcttcat
gcaaaacgtcatgctctggagtcgtggaggcaactggtagaaattatactgacagcttgt
ccccaggacctcattcaggcagaggatcgacaactgattattcgtgatattttacaagat
gtgcatgataagatactggatgatgaagctgcgcaagagttaatgcctgtggtcgccggg
gcagtgttcacactgactgctcacctaagccaggccgtcctcactgaacagaagcaaaca
tcagtcttgggaccagcagaggcccattacgcttttatgcttgatagttgcttcacctca
cctcctcctgaagagaacccattagtgggttttgcttctattggagattcttcactttac
atcatattgaagaaactgttaaacttcattttgaagacaggtggtggattccaacgagtg
aggactcacttgtatggctctctgctttattacttacagattgcccagagacctgatgaa
ccagacaccttagaagcagccaagaaaaccatgtgggaaaggctgacagcccctgaagat
gtatttagcaaattacagcgagaaaacatagccattattgaaagttatggcgccgccctc
atggaagtggtctgtcgagatgcttgtgatggtcatgagattggaaggatgctggccctg
gctctacttgatagaattgtctccgtggataaacagcagcagtggcttttgtatctttct
aacagtggctacttgaaggtcctcgtagacagcttggtagaagatgaccgtactttgcag
agcttactcaccccacagcctccccttttaaaagcactttatacttatgaatctaaaatg
gcatttctcacaagagtggcaaagatacagcagggtgcattagagctgctaagatcaggg
gtgattgtgagactagctcaatgccaagtctatgacatgcgcccagaaacggacccgcag
agcatgtttggcatgagagaccctccaatgttcatccctaccccagtggatcgctaccgc
cagattctcctcccagctctccagctgtgccaggtcatcctcacatctagtatggcccag
cacttgcaggcagcagggcaggtattgcagtttcttatttcacattctgataccatacaa
gcaattctgcgctgtcaggatgttagtgctgggtctttgcaggaattggctctgctgaca
ggaattataagtaaagcagcacttcctgggatattaagtgaacttgacgttgatgtaaat
gaagggtctctaatggagctacagggacatattggaagattccagcgccagtgcttagga
ctactaagtcgctttggtggctctgacagactgcgtcagtttaaatttcaagacgataat
gtggagggagataaagtaagcaagaaagatgagattgaactggctatgcagcagatttgt
gccaatgtaatggaatattgccagtcactcatgttacagagttcctctaccttccagcat
gctgtgtgtctcttcactcctagcctttcagaaacagttaatagagatggaccgcggcaa
gatacccaagctccagtggttccatactggcgcctgcctggtttaggcattatcatctac
ctgctgaaacagagtgctaatgatttcttcagctattatgacagtcatcgacagagtgtc
agcaagctacaaaatgtagagcagcttcccccagatgagataaaagagttgtgtcagtct
gtgatgcctgctggtgttgataaaatctccactgcccagaaatatgttctagcaagacgg
cgcttggtgaaggtgatcaacaatcgagctaaactgctttccctttgttcttttatcata
gagacctgcctatttattctttggcgccatctggagtactacttgttacattgcatggcc
acggattctcaagattccttatttgcctcgagaaccttgtttaaaagcagaagactgcaa
gattccttcgcctcagaaaccaatctagattttagaagtgggctggctatagtgagccaa
catgatttagaccagcttcaggctgatgcaatcaacgcttttggagaatcactacaaaag
aaacttctggacattgaaggattatattcaaaagttcgatctcgatatagtttcatacag
gctcttgtcagacgtatccgtggcctcttgaggatatcaaggaactga

DBGET integrated database retrieval system