KEGG   Pan paniscus (bonobo): 100975395Help
Entry
100975395         CDS       T02283                                 

Definition
eukaryotic translation initiation factor 3 subunit J-like
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
pps  Pan paniscus (bonobo)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pps00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100975395
Translation factors [BR:pps03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100975395
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 205 aa AA seqDB search
MAAAAAGDSDSXDADAFSVEDPVQKVWGGGTAGGERWEGEDXDEGVNGNWDDDQDLKKEE
AEVKPEVKSSEKKKXAEKIKEKERQQKKRQEEIKKRLKEPEEPKVLTPEEQLADKLGLNK
LQEESDLELAKETFVRDVCISLEIDNLKKITNSLTVLRRKNRSKKNQKEEERCGSWRGIK
ATMKDDLADYGGYDGGYVQDYEDFM
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggcgggggactccgactcttgagacgcggatgcattctccgtggaa
gacccagtgcagaaggtgtggggcggcggcactgctggcggggagcgctgggaaggcgag
gactaagacgagggcgtcaacggtaactgggatgacgatcaagacttaaaaaaagaagaa
gcagaagtaaaaccagaggtaaaaagttcagaaaagaaaaaancagcagagaagataaaa
gagaaagaacggcaacagaaaaaaaggcaagaagaaattaaaaagaggttaaaagaacct
gaagaacctaaagtgctaacaccagaagaacaattagcagataaactggggctaaataaa
ttacaggaagagtcagacctcgaattagcaaaggaaacttttgttcgagatgtgtgtatt
tcattggaaattgataacttgaaaaagattaccaattcactgactgtacttcgccgtaaa
aacagaagcaagaaaaaccaaaaagaagaagaaaggtgtggttcctggagagggataaaa
gccaccatgaaagatgatctggcagattatggtggttatgatggaggttatgtacaagac
tatgaagacttcatgtga

DBGET integrated database retrieval system