KEGG   Pan paniscus (bonobo): 100975618Help
Entry
100975618         CDS       T02283                                 

Gene name
PRKAA1
Definition
(RefSeq) protein kinase AMP-activated catalytic subunit alpha 1
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04068  FoxO signaling pathway
pps04140  Autophagy - animal
pps04150  mTOR signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04152  AMPK signaling pathway
pps04211  Longevity regulating pathway
pps04213  Longevity regulating pathway - multiple species
pps04371  Apelin signaling pathway
pps04530  Tight junction
pps04710  Circadian rhythm
pps04714  Thermogenesis
pps04910  Insulin signaling pathway
pps04920  Adipocytokine signaling pathway
pps04921  Oxytocin signaling pathway
pps04922  Glucagon signaling pathway
pps04931  Insulin resistance
pps04932  Non-alcoholic fatty liver disease (NAFLD)
pps05410  Hypertrophic cardiomyopathy (HCM)
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    100975618 (PRKAA1)
   04068 FoxO signaling pathway
    100975618 (PRKAA1)
   04151 PI3K-Akt signaling pathway
    100975618 (PRKAA1)
   04152 AMPK signaling pathway
    100975618 (PRKAA1)
   04150 mTOR signaling pathway
    100975618 (PRKAA1)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100975618 (PRKAA1)
  Cellular community - eukaryotes
   04530 Tight junction
    100975618 (PRKAA1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100975618 (PRKAA1)
   04922 Glucagon signaling pathway
    100975618 (PRKAA1)
   04920 Adipocytokine signaling pathway
    100975618 (PRKAA1)
   04921 Oxytocin signaling pathway
    100975618 (PRKAA1)
  Aging
   04211 Longevity regulating pathway - mammal
    100975618 (PRKAA1)
   04213 Longevity regulating pathway - multiple species
    100975618 (PRKAA1)
  Environmental adaptation
   04710 Circadian rhythm
    100975618 (PRKAA1)
   04714 Thermogenesis
    100975618 (PRKAA1)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100975618 (PRKAA1)
   05410 Hypertrophic cardiomyopathy (HCM)
    100975618 (PRKAA1)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100975618 (PRKAA1)
   04931 Insulin resistance
    100975618 (PRKAA1)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100975618 (PRKAA1)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   100975618 (PRKAA1)
Membrane trafficking [BR:pps04131]
 Autophagy
  Other autophagy associated proteins
   Others
    100975618 (PRKAA1)
Mitochondrial biogenesis [BR:pps03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100975618 (PRKAA1)
  Mitophagy factors
   Other mitophagy factors
    100975618 (PRKAA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr AdenylateSensor Kinase-like RIO1 Kdo APH
Motif
Other DBs
NCBI-GeneID: 100975618
NCBI-ProteinID: XP_003811017
Position
5
AA seq 559 aa AA seqDB search
MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNR
QKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNG
RLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEF
LRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDG
IFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMID
DEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDS
FLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDI
MAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDE
ITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPG
SHTIEFFEMCANLIKILAQ
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagactcagttcctggagaaagatggcgacagccgagaagcagaaacacgacggg
cgggtgaagatcggccactacattctgggtgacacgctgggggtcggcaccttcggcaaa
gtgaaggttggcaaacatgaattgactgggcataaagtagctgtgaagatactcaatcga
cagaagattcggagccttgatgtggtaggaaaaatccgcagagaaattcagaacctcaag
cttttcaggcatcctcatataattaaactgtaccaggtcatcagtacaccatctgatatt
ttcatggtgatggaatatgtctcaggaggagagctatttgattatatctgtaagaatgga
aggctggatgaaaaagaaagtcggcgtctgttccaacagatcctttctggtgtggattat
tgtcacaggcatatggtggtccatagagatttgaaacctgaaaatgtcctgcttgatgca
cacatgaatgcaaaaatagctgattttggtctttcaaacatgatgtcagatggtgaattt
ttaagaacaagttgtggctcacccaactatgctgcaccagaagtaatttcaggaagattg
tatgcaggcccagaggtagatatatggagcagtggggttattctctatgctttattatgt
ggaacccttccatttgatgatgaccatgtgccaactctttttaagaagatatgtgatggg
atcttctatacccctcaatatttaaatccttctgtgattagccttttgaaacatatgctg
caggtggatcccatgaagagggccacaatcaaagatatcagggaacatgaatggtttaaa
caggaccttccaaaatatctctttcctgaggatccatcatatagttcaaccatgattgat
gatgaagccttaaaagaagtatgtgaaaagtttgagtgctcagaagaggaagttctcagc
tgtctttacaacagaaatcaccaggatcctttggcagttgcctaccatctcataatagat
aacaggagaataatgaatgaagccaaagatttctatttggcgacaagcccacctgattct
tttcttgatgatcatcacctgactcggccccatcctgaaagagtaccattcttggttgct
gaaacaccaagggcacgccatacccttgatgaattaaatccacagaaatccaaacaccaa
ggtgtaaggaaagcaaaatggcatttaggaattagaagtcaaagtcgaccaaatgatatt
atggcagaagtatgtagagcaatcaaacaattggattatgaatggaaggttgtaaaccca
tattatttgcgtgtacgaaggaagaatcctgtgacaagcacttactccaaaatgagtcta
cagttataccaagtggatagtagaacttatctactggatttccgtagtattgatgatgaa
attacagaagccaaatcagggactgctactccacagagatcgggatcagttagcaactat
cgatcttgccaaaggagtgattcagatgctgaggctcaaggaaaatcctcagaagtttct
cttacctcatctgtgacctcacttgactcttctcctgttgacctaactccaagacctgga
agtcacacaatagaattttttgagatgtgtgcaaatctaattaaaattcttgcacaataa

DBGET integrated database retrieval system