KEGG   Pan paniscus (bonobo): 100975624Help
Entry
100975624         CDS       T02283                                 

Gene name
CAPN1
Definition
calpain 1, (mu/I) large subunit
Orthology
K01367  
calpain-1 [EC:3.4.22.52]
Organism
pps  Pan paniscus (bonobo)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:pps00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100975624 (CAPN1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100975624 (CAPN1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100975624 (CAPN1)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.52  calpain-1
     100975624 (CAPN1)
Peptidases [BR:pps01002]
 Cysteine Peptidases
  Family C2: calpain family
   100975624 (CAPN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 714 aa AA seqDB search
MSEEIIMPVYCTGVSAQVQKQRARELGLGRHENAIKYLGQDYEQLRVRCLQSGTLFRDEA
FPPVPQSLGYKDLGPNSSKTYGIKWKRPTELLSNPQFIVDGATRTDICQGALGDCWLLAA
IASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHS
AEGNEFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDLYQIILK
ALERGSLLGCSIDISSVLDMEAITFKKLVKGHAYSVTGAKQVNYRGQMVSLIRMRNPWGE
VEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFTRLEICNLTPDALKS
RTIRKWNTTLYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLDETDDPDDYGDRESGCSFV
LALMQKHRRRERRFGRDMETIGFAVYEVPPELVGQPAVHLKRDFFLANASRARSEQFINL
REVSTRFRLPPGEYVVVPSTFEPNKEGDFVLRFFSEKSAGTAELDDQIQANLPDEQVLSE
EEIDENFKALFRQLAGEDMEISVKELRTILNRIISKHKDLRTKGFSLESCRSMVNLMDRD
GNGKLGLVEFNILWNRIRNYLSIFRKFDLDKSGSMSAYEMRMAIESAGFKLNKKLYELII
TRYSEPDLAVDFDNFVCCLVRLETMFRFFKTLDTDLDGVVTFDLFKWLQLTMFA
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaggagatcatcatgccggtgtactgcaccggggtgtcagcccaagtgcagaag
cagcgggccagggagctgggcctgggccgccatgagaatgccatcaagtacctgggccag
gattatgagcagctgcgggtgcgatgcctgcagagtgggaccctcttccgtgatgaggcc
ttccccccggtgccccagagcctgggttacaaggacctgggtcccaattcctccaagacc
tatggcatcaagtggaagcgtcccacggagctgctgtcaaacccccagttcatcgtggat
ggagctacccgcacagacatctgccagggagcactgggggactgctggctcttggcggcc
atcgcctccctcactctcaacgacaccctcctgcaccgagtggttccccacggccagagc
ttccagaatggctatgccggcatcttccatttccagctgtggcaatttggggagtgggtg
gacgtggtcgtcgatgacctgctgcccatcaaggacgggaagctagtgttcgtgcactct
gccgaaggcaacgagttctggagcgccctgcttgagaaggcctatgccaaggtaaatggc
agctacgaggccctgtcagggggcagcacctcagagggctttgaggacttcacaggcggg
gtcaccgagtggtacgagttgcgcaaggctcccagtgacctctaccagatcatcctcaag
gcgctggagcggggctccctgctgggctgctccatagacatctccagcgttctagacatg
gaggccatcaccttcaagaagttggtgaagggccacgcctactctgtgaccggggccaag
caggtgaactaccgaggccagatggtgagcctgatccggatgcggaacccctggggcgag
gtggagtggacgggagcctggagcgacagctcctcagagtggaacaacgtggacccatat
gaacgggaccagctacgggtcaagatggaggacggggagttctggatgtcattccgagac
ttcatgcgggagttcacccgcctggagatctgcaacctcacacccgacgccctcaagagc
cggaccatccgcaaatggaacaccacactctacgaaggcacctggcggcgggggagcacc
gcggggggctgccggaactacccagccaccttctgggtgaaccctcagttcaagatccgg
ctggatgagacggatgacccggacgactacggggaccgcgagtcaggctgcagcttcgtg
ctcgcccttatgcagaagcaccgtcgccgcgagcgccgcttcggccgcgacatggagact
attggcttcgcggtctacgaggtccctccggagctggtgggccagccggccgtacacttg
aagcgtgacttcttcctggccaatgcgtctcgggcacgctcagagcagttcatcaacctg
cgagaggtcagcacccgcttccgcctgccacccggggagtatgtggtggtgccctccacc
ttcgagcccaacaaggagggcgacttcgtgctgcgcttcttctcagagaagagtgctggg
actgcggagctggatgaccagatccaggccaatctccccgatgagcaagtgctctcagaa
gaggagattgacgagaacttcaaggccctcttcaggcagctggcaggggaggacatggag
atcagcgtgaaggagttgcggacaatcctcaataggatcatcagcaaacacaaagacctg
cggaccaagggcttcagcctagagtcgtgccgcagcatggtgaacctcatggatcgtgat
ggcaatgggaagctgggcctggtggagttcaacatcctgtggaaccgcatccggaattac
ctgtccatcttccggaagtttgacctggacaagtcgggcagcatgagtgcctacgagatg
cggatggccattgagtcggcaggcttcaagctcaacaagaagctgtacgagctcatcatc
acccgctactcggagcccgacctggcggtcgactttgacaatttcgtttgctgcctggtg
cggctagagaccatgttccgatttttcaaaactctggacacagatctggatggagtcgtg
acctttgacttgtttaagtggttgcagctgaccatgtttgcatga

DBGET integrated database retrieval system