KEGG   Pan paniscus (bonobo): 100975656Help
Entry
100975656         CDS       T02283                                 

Gene name
GSTA5
Definition
glutathione S-transferase alpha 5
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
pps  Pan paniscus (bonobo)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Chemical carcinogenesis
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:pps00480]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:pps00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:pps00982]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:pps05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 222 aa AA seqDB search
MAEKPKLHYSNARGRMESIRWLLAAAGVEFEEKFLESAEDLDKLRNDGSLLFQQVPMVEI
DGMKLVQTRAILNYIASKYNLYGKDMKERALIDMYTEGIVDLTEMIVLLLVCQPEERDAK
TALVKEKIKNRYFPAFEKVLKSQGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPL
LKALKTRISNLPTVKKFLQPGSQRKPPMDEKSLEEARKIFRF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaagcccaagctccactactccaatgcacggggcagaatggagtccatccgg
tggctcctggctgcagctggagtagagtttgaagagaaatttctagaatctgcagaagat
ttggacaagttaagaaatgatgggagtttgctgttccagcaagtaccaatggttgagatt
gacgggatgaagctggtgcagaccagagccattcttaactacattgccagcaaatacaac
ctttatgggaaagacatgaaggagagagccctgattgatatgtacacagaaggtatagta
gatttgactgaaatgatcgttcttctgctcgtatgtcaaccagaggaaagagatgccaag
actgccttggtcaaagagaaaataaaaaatcgctacttccctgcctttgaaaaagtctta
aagagccagggacaagactaccttgttggcaacaagctgagccgggctgacattcacctg
gtggaacttctctactacgtggaagagcttgactcgagtcttatctccagcttccctctg
ctgaaggccctgaaaaccagaatcagcaacctgcccacggtgaagaagtttctgcagcct
ggcagccagagaaagcctcccatggatgagaaatctttagaagaagcaaggaagattttc
aggttttaa

DBGET integrated database retrieval system