KEGG   Pan paniscus (bonobo): 100976044Help
Entry
100976044         CDS       T02283                                 

Gene name
MRPS18B
Definition
mitochondrial ribosomal protein S18B
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
pps  Pan paniscus (bonobo)
Pathway
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pps00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100976044 (MRPS18B)
Ribosome [BR:pps03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    100976044 (MRPS18B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 337 aa AA seqDB search
MRSKSRSDWPRKNAILRSNSIVTQLKLASPPCLPFHASVLTQTWGRLPHCGRVLGPALLS
FLKHAQLPFRQFLSWAYVKMAASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEED
SLSSVPISPYKDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVV
GNPCPICRDHKLHVDFRNVKLLEQFVCAHTGIIFHAPYTGVCVKQHKRLTQAIQKARDHG
LLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSGDPWYPWYNWKQPPERELSRLRRLYQ
GHLREESGPPPESMPKMPPRTPAEASSTGQTGPQSAL
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcgatctaagagtcgtagtgactggccaagaaaaaacgcaattttgaggtctaattcg
attgtgacgcagttgaaattagcttctcccccatgcctcccctttcacgcttccgtcctg
acgcaaacgtggggccgccttccgcactgcgggcgtgtccttggccctgccctactcagt
ttcctgaagcatgcgcagttgcctttccgtcaattcctgtcctgggcgtacgtcaagatg
gcggcgtctgtattaaacaccgtgctgaggcggcttcctatgctatctctcttccgaggt
tctcacagagttcaggttcccctccagactctttgcaccaaagctccctctgaggaagat
tctttgtcctcagttcccatttctccttataaggatgagccctggaaatatctggaatca
gaagaataccaggagcgatatggttctcgccccgtctgggctgactaccgccgcaaccac
aagggtggtgtacccccacagcggactcggaagacatgtattcgtcggaataaagttgtt
gggaatccctgccccatctgtcgagatcacaagttgcatgttgactttaggaacgtgaag
ctcttggagcaatttgtctgcgcccacacgggtatcatcttccatgctccatacacagga
gtctgtgtgaagcagcacaagcggttgacccaggccatccagaaagccagggatcatggt
ctcctcatttaccacatcccccaggttgaaccacgggaccttgacttcagtacctctcat
ggggctgtgagtgctactccgccagcccccaccctggtctcaggtgacccctggtaccca
tggtacaactggaaacagccaccggagagagaactgtctcgccttcgccggctttaccag
ggtcatctccgagaagagagtggccccccacctgagtcaatgcccaagatgccccctaga
acaccagcggaagcctcctccactgggcagacaggccctcagagtgctctgtag

DBGET integrated database retrieval system