KEGG   Pan paniscus (bonobo): 100976044Help
Entry
100976044         CDS       T02283                                 

Gene name
MRPS18B
Definition
(RefSeq) mitochondrial ribosomal protein S18B
  KO
K16174  small subunit ribosomal protein S18b, mitochondrial
Organism
pps  Pan paniscus (bonobo)
Pathway
pps05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pps00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100976044 (MRPS18B)
Ribosome [BR:pps03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    100976044 (MRPS18B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_S18 zf-RING_10 HTH_21
Motif
Other DBs
NCBI-GeneID: 100976044
NCBI-ProteinID: XP_008957721
Position
6
AA seq 258 aa AA seqDB search
MAASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYKDEPWKYLE
SEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNV
KLLEQFVCAHTGIIFHAPYTGVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDLDFSTS
HGAVSATPPAPTLVSGDPWYPWYNWKQPPERELSRLRRLYQGHLREESGPPPESMPKMPP
RTPAEASSTGQTGPQSAL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtctgtattaaacaccgtgctgaggcggcttcctatgctatctctcttccga
ggttctcacagagttcaggttcccctccagactctttgcaccaaagctccctctgaggaa
gattctttgtcctcagttcccatttctccttataaggatgagccctggaaatatctggaa
tcagaagaataccaggagcgatatggttctcgccccgtctgggctgactaccgccgcaac
cacaagggtggtgtacccccacagcggactcggaagacatgtattcgtcggaataaagtt
gttgggaatccctgccccatctgtcgagatcacaagttgcatgttgactttaggaacgtg
aagctcttggagcaatttgtctgcgcccacacgggtatcatcttccatgctccatacaca
ggagtctgtgtgaagcagcacaagcggttgacccaggccatccagaaagccagggatcat
ggtctcctcatttaccacatcccccaggttgaaccacgggaccttgacttcagtacctct
catggggctgtgagtgctactccgccagcccccaccctggtctcaggtgacccctggtac
ccatggtacaactggaaacagccaccggagagagaactgtctcgccttcgccggctttac
cagggtcatctccgagaagagagtggccccccacctgagtcaatgcccaagatgccccct
agaacaccagcggaagcctcctccactgggcagacaggccctcagagtgctctgtag

DBGET integrated database retrieval system