KEGG   Pan paniscus (bonobo): 100976294Help
Entry
100976294         CDS       T02283                                 

Gene name
CDK4
Definition
cyclin-dependent kinase 4
Orthology
K02089  
cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
pps  Pan paniscus (bonobo)
Pathway
Cell cycle
p53 signaling pathway
PI3K-Akt signaling pathway
Tight junction
T cell receptor signaling pathway
Hepatitis B
Measles
HTLV-I infection
Pathways in cancer
Viral carcinogenesis
Pancreatic cancer
Glioma
Melanoma
Bladder cancer
Chronic myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:pps04151]
Cellular Processes; Cell growth and death; Cell cycle [PATH:pps04110]
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:pps04115]
Cellular Processes; Cell communication; Tight junction [PATH:pps04530]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:pps04660]
Human Diseases; Cancers; Pathways in cancer [PATH:pps05200]
Human Diseases; Cancers; Viral carcinogenesis [PATH:pps05203]
Human Diseases; Cancers; Pancreatic cancer [PATH:pps05212]
Human Diseases; Cancers; Glioma [PATH:pps05214]
Human Diseases; Cancers; Chronic myeloid leukemia [PATH:pps05220]
Human Diseases; Cancers; Melanoma [PATH:pps05218]
Human Diseases; Cancers; Bladder cancer [PATH:pps05219]
Human Diseases; Cancers; Small cell lung cancer [PATH:pps05222]
Human Diseases; Cancers; Non-small cell lung cancer [PATH:pps05223]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:pps05166]
Human Diseases; Infectious diseases; Measles [PATH:pps05162]
Human Diseases; Infectious diseases; Hepatitis B [PATH:pps05161]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 303 aa AA seqDB search
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEG
NPE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggctacctctcgatatgagccagtggctgaaattggtgtcggtgcctatgggacagtg
tacaaggcccgtgatccccacagtggccactttgtggccctcaagagtgtgagagtcccc
aatggaggaggaggtggaggaggccttcccatcagcacagttcgtgaggtggctttactg
aggcgactggaggcttttgagcatcccaatgttgtccggctgatggacgtctgtgccaca
tcccgaactgaccgggagatcaaggtaaccctggtgtttgagcatgtagaccaggaccta
aggacatatctggacaaggcacccccaccaggcttgccagccgaaaccatcaaggatctg
atgcgccagtttctaagaggcctagatttccttcatgccaattgcatcgttcaccgagat
ctgaagccagagaacattctggtgacaagtggtggaacagtcaagctggctgactttggc
ctggccagaatctacagctaccagatggcacttacacccgtggttgttacactctggtac
cgagctcccgaagttcttctgcagtccacatatgcaacacctgtggacatgtggagtgtt
ggctgtatctttgcagagatgtttcgtcgaaagcctctcttctgtggaaactcagaagcc
gaccagttgggcaaaatctttgacctgattgggctgcctccagaggatgactggcctcga
gatgtatccctgccccgtggagcctttccccccagagggccccgcccagtgcagtcggtg
gtacctgagatggaggagtcgggagcacagctgctgctggaaatgctgacttttaaccca
cacaagcgaatctctgcctttcgagctctgcagcactcttatctacataaggatgaaggt
aatccggagtga

DBGET integrated database retrieval system