KEGG   Pan paniscus (bonobo): 100976531Help
Entry
100976531         CDS       T02283                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L3-like
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
pps  Pan paniscus (bonobo)
Brite
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100976531
Peptidases [BR:pps01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   100976531
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 159 aa AA seqDB search
MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITE
KYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLK
KFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQTET
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggagggtcaacgctggctgccgctggaggccaatcccgaggtcaccaaccagtttctt
aaacaattaggtctacatcctaactggcaattcgttgatgtatatggaatggatcctgaa
ctccttagcatggtaccaagaccagtctgtgcagtcttacttctctttcctattacagaa
aagtatgaagtattcagaacagaagaggaagaaaaaataaaatctcagggacaagatgtt
acatcatcagtatatttcatgaagcaaacaatcagcaatgcctgtggaacaattggactg
attcatgctattgcaaacaataaagacaagatgcactttgaatctggatcaaccttgaaa
aaattcctggaggaatctgtgtcaatgagccctgaagaacgagccagatacctggagaac
tatgatgccatccgagttactcatgagaccagtgcccatgaaggtcagactgagacctaa

DBGET integrated database retrieval system