KEGG   Pan paniscus (bonobo): 100976704Help
Entry
100976704         CDS       T02283                                 

Gene name
UGT2B7
Definition
UDP glucuronosyltransferase 2 family, polypeptide B7
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
pps  Pan paniscus (bonobo)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100976704 (UGT2B7)
   00053 Ascorbate and aldarate metabolism
    100976704 (UGT2B7)
   00500 Starch and sucrose metabolism
    100976704 (UGT2B7)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100976704 (UGT2B7)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100976704 (UGT2B7)
   00860 Porphyrin and chlorophyll metabolism
    100976704 (UGT2B7)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100976704 (UGT2B7)
   00982 Drug metabolism - cytochrome P450
    100976704 (UGT2B7)
   00983 Drug metabolism - other enzymes
    100976704 (UGT2B7)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100976704 (UGT2B7)
Enzymes [BR:pps01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100976704 (UGT2B7)
Glycosyltransferases [BR:pps01003]
 Others
  Hydrophobic molecule
   100976704 (UGT2B7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 529 aa AA seqDB search
MSVKWTSVILLIQLSFCFSSGNCGKVLVWAAEYSHWMNIKTILDELIQRGHEVTVLASSA
SILFDPNNSSALKIEIYPTSVTKTELENFIMQQIKRWSDLPKDTFWLYFSQVQEIMSIFG
DITRKFCKDVVSNKKFMKKVQESRFDVIFADAIFPCSELLAELFNIPFVYSLSFSPGYTF
EKHSGGFIFPPSYVPVVMSELTDQMTFMERVKNMIYVLYFDFWFEIFDMKKWDQFYSEVL
GRPTTLSETMGKADVWLIRNSWNFQFPYPLLPNVDFVGGLHCKPAKPLPKEMEDFVQSSG
ENGVVVFSLGSMVSNMTEERANVIASALAQIPQKVLWRFDGNKPDTLGLNTRLYKWIPQN
DLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFADQPDNIAHMKARGAAVRVDFNTM
SSTDLLNALKTVINDPSYKENVMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAA
HDLTWFQYHSLDVIGFLLACVAIVIFIVTKCCLFCFWKFSRKAKKGKND
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgaaatggacttcagtaattttgctaatacaactgagcttttgctttagctct
gggaattgtggaaaggtgctggtgtgggcagcagaatatagccattggatgaatataaag
acaatcctggatgagcttattcagagaggtcatgaggtgactgtactggcatcttcagct
tccattctttttgatcccaacaactcatccgctcttaaaattgaaatttatcccacatct
gtaactaaaactgagttggagaatttcatcatgcaacagattaagagatggtcagacctt
ccaaaagatacattttggttatatttttcacaagtacaggaaatcatgtcaatatttggt
gacataactagaaagttctgtaaagatgtagtttcaaataagaaatttatgaaaaaagta
caagagtcaagatttgacgtcatttttgcagatgctatttttccctgtagtgagctgctg
gctgagctatttaacataccctttgtgtacagtctcagcttctctcctggctacactttt
gaaaagcatagtggaggatttattttccctccttcctatgtacctgttgttatgtcagaa
ttaactgatcaaatgactttcatggagagggtaaaaaatatgatctatgtgctttacttt
gacttttggttcgaaatatttgacatgaagaagtgggatcagttttatagtgaagttcta
ggaagacccactacattatctgagacaatggggaaagctgacgtatggcttattcgaaac
tcctggaattttcagtttccatatccactcttaccaaatgttgattttgttggaggactc
cactgcaaacctgccaaacccctgcctaaggaaatggaagactttgtacagagctctgga
gaaaatggtgttgtggtgttttctctggggtcaatggtcagtaacatgacagaagaaagg
gccaacgtaattgcatcagcccttgcccagatcccacaaaaggttctgtggagatttgat
gggaataaaccagataccttaggtctcaatactcggctctacaagtggataccccagaat
gaccttctaggtcatccaaagaccagagcttttataactcatggtggagccaatggcatc
tacgaggcaatctaccatgggatccctatggtggggattccattgtttgccgatcaacct
gataacattgctcacatgaaggccaggggagcagctgttagagtggacttcaacacaatg
tcgagtacagacttgctgaatgcattgaagacagtaattaatgatccttcatataaagag
aatgttatgaaattatcaagaattcaacatgatcaaccagtgaagcccctggatcgagca
gtcttctggattgaatttgtcatgcgccacaaaggagctaaacaccttcgggttgcagcc
cacgacctcacctggttccagtaccactctttggatgtgattgggttcctgctggcctgt
gtggcaattgtgatatttatcgtcacaaaatgttgtctgttttgtttctggaagttttct
agaaaagcaaagaagggaaaaaatgattag

DBGET integrated database retrieval system