KEGG   Pan paniscus (bonobo): 100977305Help
Entry
100977305         CDS       T02283                                 

Gene name
KCNMB1
Definition
potassium large conductance calcium-activated channel, subfamily M, beta member 1
Orthology
K04937  
potassium large conductance calcium-activated channel subfamily M beta member 1
Organism
pps  Pan paniscus (bonobo)
Pathway
cGMP-PKG signaling pathway
Vascular smooth muscle contraction
Insulin secretion
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    100977305 (KCNMB1)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    100977305 (KCNMB1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    100977305 (KCNMB1)
Ion channels [BR:pps04040]
 Voltage-gated cation channels
  K+ channel, KCNM, KCa1.x
   100977305 (KCNMB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 191 aa AA seqDB search
MVKKLVMAQKRGETRALCLGVTMVVCAVITYYILVTTVLPLYQKSVWTQESKCHLIETNI
RDQEELKGKKVPQYPCLWVNVSAAGRWAVLYHTEDTRDQNQQCSYIPGSLDNYQTARADV
EKVRAKFQEQQVFYCFSAPRGNETSVLFQRLYGPQALLFSLFWPTFLLTGGLLIIAMVKS
NQYLSILAAQK
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagaagctggtgatggcccagaagcggggagagacacgagccctttgcctgggt
gtaaccatggtggtgtgtgccgtcatcacctactacatcctggtcacgactgtgctgccc
ctctaccagaaaagcgtgtggacccaggaatccaagtgccacctgattgagaccaacatc
agggaccaggaggagctgaagggcaagaaggtgccccagtacccatgcctgtgggtcaac
gtgtcagctgccggcaggtgggctgtgctgtaccacacggaggacactcgggaccagaac
cagcagtgctcctacatcccaggcagcctggacaattaccagacggcccgggccgacgtg
gagaaggtcagagccaaattccaagagcagcaggtcttctactgcttctccgcacctcgg
gggaatgaaaccagcgtcctattccagcgcctctacgggccccaggccctccttttctcc
ctcttctggcccaccttcctgctgaccggtggcctcctcattatcgccatggtgaagagc
aaccagtacctgtccatcctggcagcccagaagtag

DBGET integrated database retrieval system