KEGG   Pan paniscus (bonobo): 100977378Help
Entry
100977378         CDS       T02283                                 

Definition
UDP-glucuronosyltransferase 2B11-like
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
pps  Pan paniscus (bonobo)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100977378
   00053 Ascorbate and aldarate metabolism
    100977378
   00500 Starch and sucrose metabolism
    100977378
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100977378
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100977378
   00860 Porphyrin and chlorophyll metabolism
    100977378
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100977378
   00982 Drug metabolism - cytochrome P450
    100977378
   00983 Drug metabolism - other enzymes
    100977378
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100977378
Enzymes [BR:pps01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100977378
Glycosyltransferases [BR:pps01003]
 Others
  Hydrophobic molecule
   100977378
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 529 aa AA seqDB search
MALKWTSVLLLIHLSCYFSSGSCGKVLVWAAEYSHWMNMKTILKELVQRGHEVTVLASSA
SILFDPNDASTLKFEVYPTSLTKTEFENIIMQQVKRWSDIRKDSFWLYFSQEQEILWELY
DIFRNFCKDVVSNKKLMKKLQESRFDIIFADAFFPCGELLAELFNIPFVYSLFFTRGYTI
ERHSGGLIFPPSYIPIVMSKLSDQMTFMERVKNMIYVLYFDFWFQMCDMKKWDQFYSEVL
GRPTTLFETMGKADIWLMRNSWNFQFPHPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSSG
ENGVVVFSLGSIISNMTAERANVIATALAKIPQKVLWRFDGNKPDALGLNTRLYKWIPQN
DLLGHPKTRAFITHGGASGIYEAIYHGIPMVGIPLFWDQPDNIAHMKAKGAAVRLDFHTM
SSTDLLNALKTVINDPLYKENVMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAA
RDLTWFQYHSLDVIGFLLACVATVTFIITKCCLFCFWKFTRKVKKEKRD
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggctctgaaatggacatcagttcttctgctgatacatctcagttgttactttagctct
gggagttgtggaaaggtgctggtgtgggcggcagaatacagccactggatgaatatgaag
acaatcctgaaagagcttgttcagagaggtcatgaggtgactgtactggcatcttcagct
tccattctttttgatcccaatgatgcgtccactcttaaatttgaagtttatcctacatct
ttaactaaaactgaatttgagaatatcatcatgcaacaggttaagagatggtcagacatt
cgaaaagatagcttttggttatatttttcacaagaacaagaaatcctgtgggaattatat
gacatatttagaaacttctgtaaagatgtagtttcaaataagaaacttatgaaaaaacta
caagagtcaagatttgacatcatttttgcagatgctttttttccttgtggtgagctgctg
gctgagctatttaacataccctttgtgtacagtctcttcttcactcgtggctacacaatt
gaaaggcacagtggaggactgattttccctccttcctacatacctattgttatgtcaaaa
ttaagtgatcaaatgactttcatggagagggtaaaaaatatgatctatgtgctttatttt
gacttttggttccaaatgtgtgatatgaagaagtgggatcagttttacagtgaagtttta
ggaagacccactaccttatttgagacaatggggaaagctgacatatggcttatgcgaaac
tcctggaattttcagtttcctcatccattcttaccaaacgttgattttgttggaggactc
cactgcaaacctgccaaacccctacctaaggaaatggaggagtttgtacagagctctgga
gaaaatggtgttgtggtgttttctctggggtcaatcataagtaacatgacagcagaaagg
gccaatgtaatagcaacagccctggccaagatcccacaaaaggttctgtggagatttgat
gggaataaaccagatgccttaggtctcaatactcggctgtacaagtggataccccagaat
gaccttctaggtcatccaaagaccagagcttttataactcatggtggagccagtggcatc
tatgaggcgatctaccatgggatccctatggtgggcattccattgttttgggatcaacct
gataatattgctcacatgaaggccaagggagcagctgttagattggacttccacacaatg
tcgagtacagacttgttgaatgcactgaagacagtaattaatgatcctttatataaagag
aatgttatgaaattatcaagaattcaacatgatcaaccagtgaagcccctggatagagca
gtcttctggattgaatttgtcatgcgccacaaaggagccaaacaccttcgagttgcagcc
cgtgacctcacctggttccagtaccactctttggatgtgattgggtttctgctagcctgt
gtggcaactgtgacatttatcatcacaaagtgttgtctgttttgtttctggaagtttact
agaaaagtgaagaaggaaaaaagagattag

DBGET integrated database retrieval system