KEGG   Pan paniscus (bonobo): 100977452Help
Entry
100977452         CDS       T02283                                 

Gene name
ART4
Definition
ADP-ribosyltransferase 4 (Dombrock blood group)
Orthology
K06717  
ADP-ribosyltransferase 4 [EC:2.4.2.31]
Organism
pps  Pan paniscus (bonobo)
Brite
Enzymes [BR:pps01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100977452 (ART4)
Cellular antigens [BR:pps04090]
 Proteins
  100977452 (ART4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 347 aa AA seqDB search
MDETERKPQRRTLRIHLRMKLQGQRRSTCDTSKWGPLINRCKKILLPTTVPPATTRIWLL
GGPLPFLLLLSGLQRPTEGSEVAIKIDFDFAPGSFDDQYQGCSKQVMEKLTQGDYFTKDI
EAQKNYFRMWQKAHLAWLNQGKVLPQNMTTTHAVAILFYTLNSNVHSDFTRAMASVARTP
QQYERSFHFKYLHYYLTSAIQLLRKDSIMENGTLCYEVHYRTKDVHFNAYTGATIRFGQF
LSTSLLKEEAQEFGNQTLFTIFTCLGAPVQYFSLKKEVLIPPYELFKVINMSYHPRGNWM
QLRSTGNLSTYNCQLLKASSKKCIPDPIAIASLSFLTSVIIFSKSRV
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggatgagactgaaagaaaacctcaaaggagaactctgagaattcatctcaggatgaag
ctgcaagggcaaaggagaagtacttgtgacacaagcaaatggggtccattgatcaacaga
tgcaagaagattcttctcccaactactgtacctcctgcaacgacgagaatctggctcctt
ggaggcccgctgccattcctgctgctcctctctggcctgcagagacccacagagggttct
gaggttgcaattaaaatcgactttgacttcgcaccaggttcttttgatgatcagtaccaa
ggctgtagcaaacaggttatggagaaactaactcaaggggattatttcacaaaagacata
gaagcccagaagaattattttaggatgtggcaaaaagcccacttagcctggcttaaccaa
ggaaaagttctaccccagaacatgactaccacacacgctgtggctattttgttttataca
ttgaatagcaatgttcattctgactttacgagagccatggcctctgttgccaggactcca
cagcagtatgaacgttcattccacttcaaatatttacactactacctcacctcagcaatc
cagctgctgaggaaagacagcatcatggagaatggcactctgtgctatgaggtgcattat
aggacaaaggatgtccactttaatgcctacacaggggccaccattcgatttggccaattc
ctctccacatccctcctgaaagaagaggcacaggaatttgggaaccagacactatttacc
atattcacctgcctgggtgcacctgtacagtacttctccctcaagaaggaagtcttgatc
cctccctatgagctatttaaagttataaatatgagctaccacccaagaggaaactggatg
cagttgaggtcaactgggaacctgagcacatataactgtcagctgctaaaagcttccagc
aagaaatgcatccctgatcctatagctattgcatctctctcctttttgaccagtgtcatc
atcttttccaaaagcagagtataa

DBGET integrated database retrieval system