KEGG   Pan paniscus (bonobo): 100977742Help
Entry
100977742         CDS       T02283                                 

Gene name
PTPRR
Definition
protein tyrosine phosphatase, receptor type, R
Orthology
K04458  
receptor-type tyrosine-protein phosphatase R [EC:3.1.3.48]
Organism
pps  Pan paniscus (bonobo)
Pathway
MAPK signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:pps04010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 657 aa AA seqDB search
MRRAVCFPALCLLLNLHAAGCFSGNNDHFLAINQKKSGKPVFIYQHSQDIEKSLDIAPQK
IYRHSYRSSSEAQVSKRHQIVNSAFPRPAYDPSLNLLAMDGQDLEVENLPIPAANVIVVT
LQMDVNKLNITLLRIFRQGVAAALGLLPQQVHINRLIGKKNSIELFVSPINRKTGISDAL
PSEEVLRSLNINVLHQSLSQFGITEVSPEKNVLQGQHEADKIWSKEGFYAVVIFLSIFVI
IVTCLMILYRLKERFQLSLRQDKEKNQEIHLSPITLQPALSEAKTVHSMVQPEQAPKVLN
VVVDPQGRGAPEIKATTATSVCPSPFKMKPIGLQERRGSNVSLTLDMSSLGNIEPFVSIP
TPREKVAMEYLQSASRILTRSQLRDVVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNR
YKTILPNPLSRVCLRPKNVTDSLSTYINANYIRGYSGKEKAFIATQGPMINTVDDFWQMV
WQEDSPVIVMITKLKEKNEKCVLYWPEKRGIYGKVEVLVISVNECDNYTIRNLVLKQGSH
TQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLASQGRGPVVVHCSAGIGRTGCFIA
TSIGCRQLKEEGVVDALSIVCQLRMDRGGMVQTSEQYEFVHHALCLYESRLSAETVQ
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgcggagagcagtctgcttccctgcgctgtgcctgctccttaatcttcacgctgcaggg
tgcttttcaggaaacaatgatcattttttggcaattaatcagaagaagagtgggaagccg
gtattcatttatcagcattcacaagacattgagaagagccttgatatagccccacaaaaa
atctacagacatagctaccgttcctcttccgaagctcaagtaagcaaacgccaccagatt
gtcaattcagcatttcctagacctgcatatgacccgtctctcaatctgctggccatggat
ggtcaagatcttgaagtggaaaatctcccaatcccagcagcaaatgtaattgtggtgaca
ctgcaaatggatgtaaacaagctgaacataaccttgcttcggatcttccgccaaggagtg
gctgcagctttaggactcttaccccagcaagtgcacatcaatcgcctcattggaaagaag
aacagtattgaactgtttgtgtctcccataaaccgaaaaacaggaatttctgatgctctg
ccctctgaggaagttcttcgttcacttaatatcaatgttttgcatcaaagtttatcccag
tttggaattacagaagtctctcctgagaaaaatgttttacaagggcagcatgaagcggac
aaaatctggagcaaagaaggattttatgctgttgtcatttttctcagcatctttgttatt
atagtaacgtgtttgatgattctttacagattaaaagaaagatttcagctttccttaaga
caagacaaagagaaaaaccaggagatccacctatcgcccatcacattacagccagcactg
tccgaggcaaagacagtccacagcatggtccaacctgagcaggccccaaaggtactgaat
gttgtcgtggaccctcaaggccgaggtgctcctgagatcaaagctaccaccgctacctct
gtttgcccttctcctttcaaaatgaagcccataggacttcaagagagaagagggtccaac
gtatctcttacattggacatgagtagcttggggaacattgaaccctttgtgtctatacca
acaccacgggagaaggtagcaatggagtatctgcagtcagccagccgaattctcacaaga
tctcagctgagggacgtcgtggcaagttcacatttactccaaagtgaattcatggaaata
ccaatgaactttgtggatcccaaagaaattgatattccacgtcatggaactaaaaatcgc
tataagaccattttaccaaatcctctcagcagagtgtgtttaagaccaaaaaatgtaacc
gattcattgagcacctacattaatgctaattatattaggggctacagtggcaaggagaaa
gccttcattgccacgcagggccccatgatcaacaccgtggatgatttctggcagatggtt
tggcaggaagacagccctgtgattgttatgatcacaaaactcaaagaaaaaaatgagaaa
tgtgtgctatactggccggaaaagagagggatatatggaaaagttgaggttctggttatc
agtgtaaatgaatgtgataactacaccattcgaaaccttgtcttaaagcaaggaagccac
acccaacatgtgaagcattactggtacacctcatggcctgatcacaagactccagacagt
gcccagcccctcctacagctcatgctggatgtagaagaagacagacttgcttcccagggc
cgagggcctgtggttgtccactgcagtgcaggaataggtagaacagggtgttttattgct
acatccattggctgtcgacagctgaaagaagaaggagttgtggatgcactaagcattgtc
tgccagcttcgtatggatagagggggaatggtgcaaaccagtgagcagtatgaatttgtg
caccatgctctgtgcctgtatgagagcagactttcagcagagactgtccagtga

DBGET integrated database retrieval system