KEGG   Pan paniscus (bonobo): 100978260Help
Entry
100978260         CDS       T02283                                 

Gene name
PRKG2
Definition
protein kinase, cGMP-dependent, type II
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
pps  Pan paniscus (bonobo)
Pathway
cGMP-PKG signaling pathway
Gap junction
Platelet activation
Circadian entrainment
Long-term depression
Olfactory transduction
Salivary secretion
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    100978260 (PRKG2)
 Cellular Processes
  Cell communication
   04540 Gap junction
    100978260 (PRKG2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100978260 (PRKG2)
  Digestive system
   04970 Salivary secretion
    100978260 (PRKG2)
  Nervous system
   04730 Long-term depression
    100978260 (PRKG2)
  Sensory system
   04740 Olfactory transduction
    100978260 (PRKG2)
  Environmental adaptation
   04713 Circadian entrainment
    100978260 (PRKG2)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     100978260 (PRKG2)
Protein kinases [BR:pps01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   100978260 (PRKG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 762 aa AA seqDB search
MGNGSVKPKHSKHPDGHSGNLTTDALRNKVTELERELRRKDAEIQEREYHLKELREQLSK
QTVAIAELTEELQNKCIQLNKLQDVVHMQGGSPLQASPDKVPLEVHRKTSGLVSLHSRRG
AKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDM
VECMYGRNYQQGSYIIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNC
TRTASVKAITNVKTWALDREVFQNIMRRTAQARDEQYRNFLRSVSLLKNLPEDKLTKIID
CLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKAL
ISDDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAKRS
MSNWKLSKALSLEMIQLKEKVARFSSSSPFQNLEIIATLGVGGFGRVELVKVKNENVAFA
MKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWS
ILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDAEGYLKLVDFGFAKK
IGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGVDQMMTYN
LILKGIEKMDFPRKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLK
ARSLPSPLQRELKGPIDHSYFDKYPPEKGMPPDELSGWDKDF
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatggttcagtgaaacctaaacattccaagcacccagatggacactctgggaac
ctcaccactgatgctctgcggaacaaggtgacagagctggagagagagttgaggaggaag
gatgctgagatccaggagcgggagtaccatttgaaggagctgcgggagcagctgtcgaag
cagactgtggccattgctgaactcacagaggagctccagaacaagtgcatccagctgaac
aagctgcaggatgtggtgcatatgcagggaggaagcccgcttcaggcctcaccagataaa
gtgcctcttgaggtccaccggaagacctctggattggtctctctccatagcaggagggga
gcaaaggctggcgtgtctgctgagccaacaacccggacctatgacctgaacaaaccccct
gaattttcctttgagaaagcaagagtcagaaaagactccagtgagaagaagctcattaca
gatgcccttaataaaaatcagtttctgaaaagactggatcctcagcagatcaaagacatg
gtggaatgcatgtatgggagaaactatcagcaagggagttacattattaagcaaggagaa
ccaggaaaccatatctttgtgctggcagagggtcgactagaggtgttccaaggggagaaa
ttgctgtcctccatccctatgtggaccacatttggggagcttgccattttatacaactgt
acaaggactgcctctgtgaaagctattaccaatgttaaaacgtgggcactagatcgagag
gtattccagaatataatgaggagaacagcccaagctagagatgaacaatacagaaacttc
ctcagaagtgtatccttgctgaagaatttacctgaagataaattaaccaagatcattgac
tgcttggaagtggaatactatgacaaaggagattacatcattagagagggcgaggaagga
agtacctttttcattttggcaaaaggaaaggtaaaagtaacacagagcacagaaggccat
gatcaaccacagctgataaaaacactgcagaaaggagaatactttggagaaaaagctctt
atcagtgatgatgtcaggtcagctaacattattgctgaagaaaatgatgttgcatgcctg
gttatagatcgagaaacattcaaccaaactgtcggtacatttgaagagctgcaaaaatac
cttgaaggatatgtggcaaacctgaaccgtgatgatgaaaaaagacatgcgaagcggtcc
atgtctaactggaagctgtccaaagcactctctctggaaatgattcagctgaaggagaag
gtggccagattttcctcatcatccccattccagaaccttgagattattgcaacactgggc
gttggtgggttcggaagagttgagcttgttaaagtaaaaaatgagaatgttgcttttgct
atgaagtgtataaggaagaagcacatagttgacaccaagcagcaggagcatgtctactca
gagaagaggatcctagaggagctgtgctctccattcattgtgaaattatatcgtactttc
aaggacaataagtatgtatacatgcttctggaggcctgcttaggtggggagctctggagt
atattaagggacagaggcagctttgatgaacccacctccaaattctgcgttgcttgtgtg
acagaagcatttgattacctgcatcgactaggtattatctacagagacttgaaaccagaa
aacttaattctagatgctgagggttaccttaaattggttgactttggatttgcgaagaaa
atagggtctggacagaaaacatggacattctgtgggactccagaatatgtagctcctgaa
gtcattctcaacaagggacatgacttcagtgtggatttctggtcactgggaattctagtg
tatgagctcctaacgggcaacccacccttttctggggttgaccaaatgatgacctacaat
ttgattctcaaaggaattgaaaaaatggattttcccaggaagataacacgacgacctgag
gatttgattcggaggctttgcaggcaaaatccaacagaaaggctgggaaatctgaagaat
ggaataaatgacattaagaaacacaggtggttaaatggttttaattgggagggactgaaa
gcacggagccttccatcacctttgcaaagagagctcaagggacccatagatcacagctac
tttgacaaatatcctcctgaaaagggaatgcctccagatgagctatcaggctgggataaa
gacttctga

DBGET integrated database retrieval system