KEGG   Pan paniscus (bonobo): 100978769Help
Entry
100978769         CDS       T02283                                 

Gene name
HDAC3
Definition
(RefSeq) histone deacetylase 3
  KO
K11404  
histone deacetylase 3 [EC:3.5.1.98]
Organism
pps  Pan paniscus (bonobo)
Pathway
Thyroid hormone signaling pathway
Alcoholism
Human papillomavirus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pps00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100978769 (HDAC3)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100978769 (HDAC3)
  Substance dependence
   05034 Alcoholism
    100978769 (HDAC3)
  Infectious diseases
   05165 Human papillomavirus infection
    100978769 (HDAC3)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100978769 (HDAC3)
Chromosome [BR:pps03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     100978769 (HDAC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
5
AA seq 428 aa AA seqDB search
MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCR
FHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNN
KICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEA
FYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVI
NQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTV
RNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQ
TIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDN
DKESDVEI
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaccgtggcctatttctacgaccccgacgtgggcaacttccactacggagct
ggacaccctatgaagccccatcgcctggcattgacccatagcctggtcctgcattacggt
ctctataagaagatgatcgtcttcaagccataccaggcctcccagcatgacatgtgccgc
ttccactccgaggactacattgacttcctgcagagagtcagccccaccaatatgcaaggc
ttcaccaagagtcttaatgccttcaacgtaggcgatgactgcccagtgtttcccgggctc
tttgagttctgctcgcgttacacaggcgcatctctgcaaggagcaacccagctgaacaac
aagatctgtgatattgccattaactgggctggtggtctgcaccatgccaagaagtttgag
gcctctggcttctgctatgtcaacgacattgtgattggcatcctggagctgctcaagtac
caccctcgggtgctctacattgacattgacatccaccatggtgatggggttcaagaagct
ttctacctcactgaccgggtcatgacggtgtccttccacaaatatggaaattacttcttc
cctggcacaggtgacatgtatgaagtcggggcagagagtggccgctactactgtctgaac
gtgcccctgcgggatggcattgatgaccagagttacaagcaccttttccagccggttatc
aaccaggtagtggacttctaccaacccacgtgcattgtgctccagtgtggagctgactct
ctgggctgtgatcgattgggctgctttaacctcagcatccgagggcatggggaatgcgtt
gaatatgtcaagagcttcaatatccctctactcgtgctgggtggtggtggttatactgtc
cgaaatgttgcccgctgctggacatatgagacatcgctgctggtagaagaggccattagt
gaggagcttccctatagtgaatacttcgagtactttgccccagacttcacacttcatcca
gatgtcagcacccgcatcgagaatcagaactcacgccagtatctggaccagatccgccag
acaatctttgaaaacctgaagatgctgaaccatgcacctagtgtccagattcatgacgtg
cctgcagacctcctgacctatgacaggactgatgaggctgatgcagaggagaggggtcct
gaggagaactatagcaggccagaggcacccaatgagttctatgatggagaccatgacaat
gacaaggaaagcgatgtggagatttaa

DBGET integrated database retrieval system