KEGG   Pan paniscus (bonobo): 100978798Help
Entry
100978798         CDS       T02283                                 

Gene name
UCHL1
Definition
(RefSeq) ubiquitin C-terminal hydrolase L1
  KO
K05611  
ubiquitin carboxyl-terminal hydrolase L1 [EC:3.4.19.12]
Organism
pps  Pan paniscus (bonobo)
Pathway
Parkinson's disease
Brite
KEGG Orthology (KO) [BR:pps00001]
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    100978798 (UCHL1)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100978798 (UCHL1)
Peptidases [BR:pps01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   100978798 (UCHL1)
Ubiquitin system [BR:pps04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    100978798 (UCHL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
4
AA seq 291 aa AA seqDB search
MQLKPMEINPEMLNKVSGVSRRLWPLPRERRGGGAHRFRLLAGTKPPAARTGDGRAGAWA
GRPSWAPAFSGCRAVGAQDAPAAGSARRSQLDGAYRLLAHPSTIALNLEERQYLSSIYPK
RFLHSQHENFRKKQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGFEDGS
VLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHL
YELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVALCKAA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgcagctcaagccaatggagatcaaccccgagatgctgaacaaagtgagtggcgtctcg
cgccgtctctggcccctcccccgcgagcgccgaggcgggggcgcccaccggttccggctg
ctggcagggactaagccgcccgctgcgcgcaccggagacggccgggctggggcgtgggct
gggcgcccttcctgggcccctgcatttagcgggtgtagggccgtgggggcccaggatgcg
ccggccgccggcagtgcacgccgctcccagcttgacggtgcctatcgccttcttgcccat
ccgtccacaattgccttaaatttggaagagaggcagtatctcagttccatctatcccaaa
cgctttttacattcgcagcatgagaacttcaggaaaaagcagattgaagagctgaaggga
caagaagttagtcctaaagtgtacttcatgaagcagaccattgggaattcctgtggcaca
atcggacttattcacgcagtggccaataatcaagataaactgggatttgaggatggatca
gttctgaaacagtttctttctgaaacagagaaaatgtcccctgaagacagagcaaaatgc
tttgaaaagaatgaggccatacaggcagcccatgatgccgtggcacaggaaggccaatgt
cgggtagatgacaaggtgaatttccattttattctgtttaacaacgtggatggccacctc
tatgaacttgatggacgaatgccttttccggtgaaccatggcgccagttcagaggacacc
ctgctgaaggacgctgccaaggtctgcagagaattcaccgagcgtgagcaaggagaagtc
cgcttctctgccgtggctctctgcaaggcagcctaa

DBGET integrated database retrieval system