KEGG   Pan paniscus (bonobo): 100979160Help
Entry
100979160         CDS       T02283                                 

Gene name
ACR
Definition
acrosin
Orthology
K01317  
acrosin [EC:3.4.21.10]
Organism
pps  Pan paniscus (bonobo)
Brite
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.10  acrosin
     100979160 (ACR)
Peptidases [BR:pps01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100979160 (ACR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 418 aa AA seqDB search
MVEMLPTAILLVLAVSVVAKDNATCDGPCGLRFRQNPQGGVRIVGGKAAQHGAWPWMVSL
QIFTYNGHRYHTCGGSLLNSRWVLTAAHCFTGKNNVHDWRLVFGAKEITYGNNKPVKAPL
QERYVEKIIIHEKYNSATEGNDIALVKITPPISCGRFIGPGCLPHFKAGLPRGSQSCWVA
GWGYIEEKAPRPSSMLMEARVDLIDLDLCNSTQWYNGRVQPTNVCAGYPVGKIDTCQGDS
GGPLMCKDSKESAYVVVGITSWGVGCARAKRPGIYTATWPYLNWIASKIGSNALHMIQSA
TRPPPTTRPPPIRPPFSHPISAHLPWYFQPPPRPLPPRPPAAQPRPHLHPCPHPHLHPHL
YPTPPPPTPSSTTKLPQGLSFAKRLQQLVEVLKGKSYPDGKNHDDMETTELPELTSTS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggttgagatgctaccaactgccattctgctggtcttggcagtgtccgtggttgctaaa
gataacgccacgtgtgatggcccctgtgggttacggttcaggcaaaacccacagggtggt
gtccgcatcgttggcgggaaggctgcacagcatggggcctggccctggatggtcagcctc
cagatcttcacgtacaacggccacaggtaccacacatgtggaggcagcttgctgaattca
cgatgggtgctcactgctgctcactgcttcactggcaaaaataatgtgcatgactggaga
ctggttttcggagcaaaggaaattacatatgggaacaataaaccagtaaaggcgcctctg
caagagagatacgtggagaaaatcatcattcatgaaaaatacaactctgcgacagaggga
aatgacattgccctcgtgaagatcacccctcccatttcgtgtgggcgcttcattgggccg
ggctgcctgccccactttaaggcaggcctccccagaggctcccagagctgctgggtggct
ggctggggatatatagaagagaaagcccccaggccatcatctatgctgatggaggcacgt
gtggatctcatcgacctggacttgtgtaactcgacccagtggtacaatgggcgtgttcag
ccaaccaatgtgtgcgcggggtatcctgtaggcaagatcgacacctgccagggggacagc
ggcgggcctctcatgtgcaaagacagcaaggaaagcgcctatgtggtcgtgggaatcaca
agctggggggtaggctgtgcccgtgccaagcgccccggaatctacacggccacctggccc
tatctgaactggatcgcctccaagattggttccaacgctttgcatatgattcaatcggcc
acccgtccacctcccaccactcgaccgcccccgattcgaccccccttctcccaccctatc
tccgctcaccttccttggtatttccaaccgccccctcgaccacttccaccccgaccacct
gcagcccagccccgaccccaccttcacccctgcccccacccccacctccaccctcacctt
taccccaccccacccccacctacaccctcatctaccacaaaacttccccaaggactttct
tttgccaagcgcctacagcagctcgtagaggtcttgaaggggaaatcctatcccgacgga
aagaaccatgatgacatggagaccacagaactcccagaactgacctcgacctcctga

DBGET integrated database retrieval system