KEGG   Pan paniscus (bonobo): 100979198Help
Entry
100979198         CDS       T02283                                 

Gene name
KAT2B
Definition
K(lysine) acetyltransferase 2B
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
pps  Pan paniscus (bonobo)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:pps04330]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:pps04919]
Human Diseases; Cancers; Viral carcinogenesis [PATH:pps05203]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:pps05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 887 aa AA seqDB search
MIERLPPPTGAGVRGSDGGPRRGEVASRCLGSRPLPPPSSPPTPQGLASPPGGRAVGVEA
LGWGVQTPRAAEKRPWGPPSAGRHREAGSRRHAHLVRSPEEHVRSQARSRVPVAAAGTAE
GPGGGGSARIAVKKAQLRSAPRAKNLEKLGVYSACKAEESCKCNGWKNPNPSPTPPRADL
QQIIVSLTESCRSCSHALAAHVSHLENVSEEEMNRLLGIVLDVEYLFTCVHKEEDADTKQ
VYFYLFKLLRKSILQRGKPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPAKERQTIV
ELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENYTRWLCYCNVPQFCDSLPRYETTQ
VFGRTLLRSVFTVMRRQLLEQARQEKDKLPLEKRTLILTHFPKFLSMLEEEVYSQNSPIW
DQDFLSASSRTSQLGIQTVINPPPVAGTISYNSTSSSLEQPSAGSSSPACKASSGLEANP
GEKRKMTDSHVLEEAKKPRVMGDIPMELINEVMSTITDPAAMLGPETNFLSAHSARDEAA
RLEERRGVIEFHVVGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKT
LALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHDILNF
LTYADEYAIGYFKKQGFSKEIKIPKTKYVGYIKDYEGATLMGCELNPRIPYTEFSVIIKK
QKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIPIESIPGIRETGWKPSGKEKSKEPRDP
DQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSK
KLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atgattgagaggctgccccctcccactggtgcaggcgtgcgggggtcggatgggggaccg
cggaggggggaggtggccagcaggtgcctgggctccaggcccctacccccaccctcgtcc
ccacccacaccccagggattggcctcgccccctggcgggcgagcggtaggtgtcgaggca
ctggggtggggggtgcaaaccccgcgggcagcggaaaagaggccatgggggcctcccagc
gctggcagacaccgtgaggctggcagccgccggcacgcacacctagtccgcagtcccgag
gaacatgtccgcagccaggcacggagcagagtcccggtggctgcagcgggcacggccgaa
ggaccgggaggcggtggctcggcccgaatcgccgtgaagaaagcgcaactacgctccgct
ccgcgggccaagaacctggagaaactcggagtgtactccgcctgcaaggccgaggagtct
tgtaaatgtaatggctggaaaaaccctaacccctcacccactccccccagagccgatctg
cagcaaataattgtcagtctaacagaatcctgtcggagttgtagccatgccctagctgct
catgtttcccacctggagaatgtgtcagaggaagaaatgaacagactcctgggaatagta
ttggatgtggagtatctctttacctgtgtccacaaggaagaagatgcagataccaaacaa
gtttatttctatctatttaagctcttgagaaagtctattttacaaagaggaaaacctgtg
gttgaaggctctttggaaaagaaacccccatttgaaaaacctagcattgaacagggtgtg
aataactttgtacagtacaaatttagtcacctgccagcaaaagaaaggcaaacaatagtt
gagttggcaaaaatgttcctaaaccgcatcaactattggcatctggaggcaccatctcaa
cgaagactgcgatctcccaatgatgatatttctggatacaaagagaactacacaaggtgg
ctgtgttactgcaacgtgccacagttctgtgacagtctacctcggtacgaaaccacacag
gtgtttgggagaacattgcttcgctcggtcttcactgttatgaggcgacaactcctggaa
caagcaagacaggaaaaagataaactgcctcttgaaaaacgaactctaatcctcactcat
ttcccaaaatttctgtccatgctagaagaagaagtatatagtcaaaactctcccatctgg
gatcaggattttctctcagcctcttccagaaccagccagctaggcatccaaacagttatc
aatccacctcctgtggctgggacaatttcatacaattcaacctcatcttcccttgagcag
ccaagcgcagggagcagcagtcctgcctgcaaagcctcttctggacttgaggcaaaccca
ggagaaaagaggaaaatgactgattctcatgttctggaggaggccaagaaaccccgagtt
atgggggatattccgatggaattaatcaacgaggttatgtctaccatcacggaccctgca
gcaatgcttggaccagagaccaattttctgtcagcacactcggccagggatgaggcggca
aggttggaagagcgcaggggtgtaattgaatttcacgtggttggcaattccctcaaccag
aaaccaaacaagaagatcctgatgtggctggttggcctacagaacgttttctcccaccag
ctgccccgaatgccaaaagaatacatcacacggctcgtctttgacccgaaacacaaaacc
cttgctttaattaaagatggccgtgttattggtggtatctgtttccgtatgttcccatct
caaggattcacagagattgtcttctgtgctgtaacctcaaatgagcaagtcaagggctat
ggaacacacctgatgaatcatttgaaagaatatcacataaagcatgacatcctgaacttc
ctcacatatgcagatgaatatgcaattggatactttaagaaacagggtttctccaaagaa
attaaaatacctaaaaccaaatatgttggctatatcaaggattatgaaggagccacttta
atgggatgtgagctaaatccacggatcccgtacacagaattttctgtcatcattaaaaag
cagaaggagataattaaaaagctgattgaaagaaaacaggcacaaattcgaaaagtttac
cctggactttcatgttttaaagatggagttcgacagattcctatagaaagcattcctgga
attagagagacaggctggaaaccaagtggaaaagagaaaagtaaagagcccagagaccct
gaccagctttacagcacgctcaagagcatcctccagcaggtgaagagccatcaaagcgct
tggcccttcatggaacctgtgaagagaacagaagctccaggatattatgaagttataagg
ttccccatggatctgaaaaccatgagtgaacgcctcaagaataggtactacgtgtctaag
aaattattcatggcagacttacagcgagtctttaccaattgcaaagagtacaacccccct
gagagtgaatactacaaatgtgccaatatcctggagaaattcttcttcagtaaaattaag
gaagctggattaattgacaagtga

DBGET integrated database retrieval system