KEGG   Pan paniscus (bonobo): 100979198Help
Entry
100979198         CDS       T02283                                 

Gene name
KAT2B
Definition
(RefSeq) K(lysine) acetyltransferase 2B
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
pps  Pan paniscus (bonobo)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100979198 (KAT2B)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100979198 (KAT2B)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100979198 (KAT2B)
  Infectious diseases
   05166 HTLV-I infection
    100979198 (KAT2B)
Enzymes [BR:pps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100979198 (KAT2B)
Transcription machinery [BR:pps03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100979198 (KAT2B)
Chromosome [BR:pps03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100979198 (KAT2B)
   HAT complexes
    PCAF complex
     100979198 (KAT2B)
    STAGA complex
     100979198 (KAT2B)
    TFTC complex
     100979198 (KAT2B)
    SAGA complex
     100979198 (KAT2B)
    SLIK complex
     100979198 (KAT2B)
    ADA-HAT complex
     100979198 (KAT2B)
    HAT-A2 complex
     100979198 (KAT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
3
AA seq 675 aa AA seqDB search
MNRLLGIVLDVEYLFTCVHKEEDADTKQVYFYLFKLLRKSILQRGKPVVEGSLEKKPPFE
KPSIEQGVNNFVQYKFSHLPAKERQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISG
YKENYTRWLCYCNVPQFCDSLPRYETTQVFGRTLLRSVFTVMRRQLLEQARQEKDKLPLE
KRTLILTHFPKFLSMLEEEVYSQNSPIWDQDFLSASSRTSQLGIQTVINPPPVAGTISYN
STSSSLEQPSAGSSSPACKASSGLEANPGEKRKMTDSHVLEEAKKPRVMGDIPMELINEV
MSTITDPAAMLGPETNFLSAHSARDEAARLEERRGVIEFHVVGNSLNQKPNKKILMWLVG
LQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVT
SNEQVKGYGTHLMNHLKEYHIKHDILNFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYI
KDYEGATLMGCELNPRIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQ
IPIESIPGIRETGWKPSGKEKSKEPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEA
PGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILE
KFFFSKIKEAGLIDK
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgaacagactcctgggaatagtattggatgtggagtatctctttacctgtgtccacaag
gaagaagatgcagataccaaacaagtttatttctatctatttaagctcttgagaaagtct
attttacaaagaggaaaacctgtggttgaaggctctttggaaaagaaacccccatttgaa
aaacctagcattgaacagggtgtgaataactttgtacagtacaaatttagtcacctgcca
gcaaaagaaaggcaaacaatagttgagttggcaaaaatgttcctaaaccgcatcaactat
tggcatctggaggcaccatctcaacgaagactgcgatctcccaatgatgatatttctgga
tacaaagagaactacacaaggtggctgtgttactgcaacgtgccacagttctgtgacagt
ctacctcggtacgaaaccacacaggtgtttgggagaacattgcttcgctcggtcttcact
gttatgaggcgacaactcctggaacaagcaagacaggaaaaagataaactgcctcttgaa
aaacgaactctaatcctcactcatttcccaaaatttctgtccatgctagaagaagaagta
tatagtcaaaactctcccatctgggatcaggattttctctcagcctcttccagaaccagc
cagctaggcatccaaacagttatcaatccacctcctgtggctgggacaatttcatacaat
tcaacctcatcttcccttgagcagccaagcgcagggagcagcagtcctgcctgcaaagcc
tcttctggacttgaggcaaacccaggagaaaagaggaaaatgactgattctcatgttctg
gaggaggccaagaaaccccgagttatgggggatattccgatggaattaatcaacgaggtt
atgtctaccatcacggaccctgcagcaatgcttggaccagagaccaattttctgtcagca
cactcggccagggatgaggcggcaaggttggaagagcgcaggggtgtaattgaatttcac
gtggttggcaattccctcaaccagaaaccaaacaagaagatcctgatgtggctggttggc
ctacagaacgttttctcccaccagctgccccgaatgccaaaagaatacatcacacggctc
gtctttgacccgaaacacaaaacccttgctttaattaaagatggccgtgttattggtggt
atctgtttccgtatgttcccatctcaaggattcacagagattgtcttctgtgctgtaacc
tcaaatgagcaagtcaagggctatggaacacacctgatgaatcatttgaaagaatatcac
ataaagcatgacatcctgaacttcctcacatatgcagatgaatatgcaattggatacttt
aagaaacagggtttctccaaagaaattaaaatacctaaaaccaaatatgttggctatatc
aaggattatgaaggagccactttaatgggatgtgagctaaatccacggatcccgtacaca
gaattttctgtcatcattaaaaagcagaaggagataattaaaaagctgattgaaagaaaa
caggcacaaattcgaaaagtttaccctggactttcatgttttaaagatggagttcgacag
attcctatagaaagcattcctggaattagagagacaggctggaaaccaagtggaaaagag
aaaagtaaagagcccagagaccctgaccagctttacagcacgctcaagagcatcctccag
caggtgaagagccatcaaagcgcttggcccttcatggaacctgtgaagagaacagaagct
ccaggatattatgaagttataaggttccccatggatctgaaaaccatgagtgaacgcctc
aagaataggtactacgtgtctaagaaattattcatggcagacttacagcgagtctttacc
aattgcaaagagtacaacccccctgagagtgaatactacaaatgtgccaatatcctggag
aaattcttcttcagtaaaattaaggaagctggattaattgacaagtga

DBGET integrated database retrieval system