KEGG   Pan paniscus (bonobo): 100979222Help
Entry
100979222         CDS       T02283                                 

Gene name
NLK
Definition
nemo-like kinase
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
pps  Pan paniscus (bonobo)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Wnt signaling pathway
Adherens junction
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100979222 (NLK)
   04310 Wnt signaling pathway
    100979222 (NLK)
   04068 FoxO signaling pathway
    100979222 (NLK)
 Cellular Processes
  Cellular commiunity
   04520 Adherens junction
    100979222 (NLK)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100979222 (NLK)
Protein kinases [BR:pps01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100979222 (NLK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 527 aa AA seqDB search
MSLCGARANAKMMAAYNGGTSAAAAGHHHHHHHHLPHLPPPHLHHHHHPQHHLHPGSAAA
VHPVQQHTSSAAAAAAAAAAAAAMLNPGQQQPYFPSPAPGQAPGPAAAAPAQVQAAAAAT
VKAHHHQHSHHPQQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCK
RVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDH
VKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQE
VVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTP
SLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKD
ALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEI
IHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtctctttgtggcgcaagagccaacgcaaaaatgatggcggcttacaatggcggtaca
tctgcagcagcagcaggtcaccaccaccaccatcaccaccaccttccacacctccctcct
cctcacctgcaccaccaccaccaccctcaacaccatcttcatccggggtcggctgccgct
gtacaccctgtacagcagcacacctcttcggcagctgcggcagccgcagcagcggctgca
gctgcagccatgttaaaccctgggcaacaacagccatatttcccatcaccggcaccgggg
caggctcctggaccagctgcagcagccccagctcaggtacaggctgccgcagctgctaca
gttaaggcgcaccatcatcagcactcgcatcatccacagcagcagctggatattgagccg
gatagacctattggatatggagcctttggtgttgtctggtcagtaacagatccaagagat
ggaaagagagtagcgctcaaaaagatgcccaacgtcttccagaatctggtctcttgcaaa
agggtcttccgggaattgaagatgttgtgtttttttaagcatgataatgtactctctgcc
cttgacatactccaacctccacacattgactattttgaagaaatatatgttgtcacagaa
ttgatgcagagtgacctacataaaattatcgtctctcctcaaccactcagctcagatcat
gtcaaagtttttctttatcagattttgcgaggtttgaaatatctccattcagctggcatt
ttacatcgagacattaagccagggaatctccttgtgaacagcaactgtgttctaaagatt
tgtgattttggattggccagagtggaagaattagatgaatcccgtcatatgactcaggaa
gttgttactcagtattatcgggctccagaaatcctgatgggcagccgtcattacagcaat
gctattgacatctggtctgtgggatgtatctttgcagaactactaggacgaagaatattg
tttcaggcacagagtcccattcagcagttggatttgatcacggatctgttgggcacacca
tcactggaagcaatgaggacagcttgtgaaggcgctaaggcacatatactcaggggtcct
cataaacagccatctcttcctgtactctataccctgtctagccaggctacacatgaagct
gttcatctcctttgcaggatgttggtctttgatccatccaaaagaatatccgctaaggat
gccttagcccacccctacctagatgaagggcgactacgatatcacacatgtatgtgtaaa
tgttgcttttccacctctactggaagagtttataccagtgactttgagcctgtcaccaat
cccaaatttgatgacactttcgagaagaacctcagttctgtccgacaggttaaagaaatt
attcatcagttcattttggaacagcagaaaggaaacagagtgcctctctgcatcaaccct
cagtctgctgcttttaagagctttattagttccactgttgctcagccatctgagatgccc
ccatctcctctggtgtgggagtga

DBGET integrated database retrieval system