KEGG   Pan paniscus (bonobo): 100979449Help
Entry
100979449         CDS       T02283                                 

Gene name
CTRB1
Definition
chymotrypsinogen B1
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
pps  Pan paniscus (bonobo)
Brite
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     100979449 (CTRB1)
Peptidases [BR:pps01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100979449 (CTRB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 263 aa AA seqDB search
MAFLWLLSCWALLGTTFGCGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVSLQDKTGFHFC
GGSLISEDWVVTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKDPKFSILTVNND
ITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQAALPL
LSNAECKKFWGRKITDVMICAGASGVSSCMGDSGGPLVCQKDGAWTLVGIVSWGSDTCST
SSPGVYARVTKLIPWVQKILAAN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggctttcctctggctcctctcctgctgggccctcctgggtaccaccttcggctgcggg
gtccccgccatccaccctgtgctcagcggcctgtccaggatcgtgaatggggaggacgcc
gtccccggctcctggccctggcaggtgtccctgcaggacaaaaccggcttccacttctgc
gggggctccctcatcagcgaggactgggtagtcaccgctgcccactgcggggtcaggacc
tccgacgtggtcgtggctggggagtttgaccagggctctgacgaggagaacatccaggtc
ctgaagatcgccaaggtcttcaaggaccccaagttcagcattctgaccgtgaacaatgac
atcaccctgctgaagctggccacacctgcccgcttctcccagacagtgtccgccgtgtgc
ctgcccagtgcggacgacgacttccccgcggggacactgtgtgccaccacaggctggggc
aagaccaagtacaatgccaacaagacccctgacaagctgcagcaggcagccctgcccctc
ctgtccaatgccgaatgcaagaagttctggggcagaaagatcaccgacgtgatgatctgt
gccggggccagtggcgtctcctcctgcatgggcgactctggcggccccctggtctgccaa
aaggatggagcctggaccctggtgggcattgtgtcctggggcagcgacacctgctccacc
tccagccctggcgtgtacgcccgtgtcaccaagctcataccttgggtgcagaagatcctg
gctgccaactga

DBGET integrated database retrieval system