KEGG   Pan paniscus (bonobo): 100979499Help
Entry
100979499         CDS       T02283                                 

Definition
histone H2B type 1-H-like
Orthology
K11252  
histone H2B
Organism
pps  Pan paniscus (bonobo)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:pps05203]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:pps05322]
Human Diseases; Substance dependence; Alcoholism [PATH:pps05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 126 aa AA seqDB search
MPDPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatccagctaagtccgctcccgccccgaagaagggctccaagaaggcggtgacc
aaggcgcagaagaaggatggcaagaagcgtaaacgcagccgcaaggagagctactccgta
tacgtttacaaggtgctgaagcaggtccaccccgacaccggcatctcctccaaagccatg
gggatcatgaattcctttgtcaacgatatcttcgagcgcatcgccggcgaggcttcccgc
ctggctcattacaacaagcgttcaaccatcacctccagggagatccagacagccgtgcgc
ctgctgctgcctggggaactggccaagcacgccgtgtccgagggcactaaggccgtcacc
aagtacaccagctccaagtaa

DBGET integrated database retrieval system