KEGG   Pan paniscus (bonobo): 100979502Help
Entry
100979502         CDS       T02283                                 

Gene name
TYMP
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
pps  Pan paniscus (bonobo)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Bladder cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    100979502 (TYMP)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100979502 (TYMP)
 Human Diseases
  Cancers
   05219 Bladder cancer
    100979502 (TYMP)
Enzymes [BR:pps01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     100979502 (TYMP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 313 aa AA seqDB search
MAALMTPGTGAPPAPGDFSGEGSQGLPDPSPEPKQLPELIRMKRDGGRLSEADIRGFVAA
VVNGSAQGAQIGAMLMAIRLRGMDLEETSVLTQALAQSGQQLEWPEAWRQQLVDKHSTGG
VGDKVSLVLAPALAACGCKVPMISGRGLGHTGGTLDKLESIPGFNVIQSPEQMQVLLDQA
GCCIVGQSEQLVPADGILYAARDVTATVDSLPLITASILSKKLVEGLSALVVDVKFGGAA
VFPNQEQARELAKTLVGVGASLGLRVAAALTAMDKPLGRCVGHALEVEEALLCMDGAGPP
DLRDLVTTLGGAL
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggcagccttgatgaccccgggaaccggggccccacccgcgcctggtgacttctccggg
gaagggagccagggacttcccgacccttcgccagagcccaagcagctcccggagctgatc
cgcatgaagcgagacggaggccgcctgagcgaagcggacatcaggggcttcgtggccgct
gtggtgaatgggagtgcgcagggcgcacagatcggggccatgctgatggccatccgactt
cggggcatggatctggaggagacctcggtgctgacccaggccctggcccagtcgggacag
cagctggagtggccagaggcctggcgccagcagcttgtggacaagcattccacagggggt
gtgggtgacaaggtcagcctggtcctcgcacctgccctggcggcatgcggctgcaaggtg
ccaatgatcagcggacgtggtctggggcacacaggaggcaccttggataagctggagtct
attcctggattcaatgtcatccagagcccagagcagatgcaagtgctgctggaccaggcg
ggctgctgtatcgtgggtcagagtgagcagctggttcctgcggacggaatcctatatgca
gccagagatgtgacagccaccgtggacagcctgccactcatcacagcctccattctcagt
aagaaactcgtggaggggctgtccgctctggtggtggacgttaagttcggaggggccgcc
gtcttccccaaccaggagcaggcccgggagctggcaaagacgctggttggcgtgggagcc
agcctagggcttcgggtcgcggcagcgctgaccgccatggacaagcccctgggtcgctgc
gtgggccacgccctggaggtggaggaggcgctgctctgcatggacggcgcaggcccacca
gacttaagggacctggtcaccacgctcgggggcgccctctga

DBGET integrated database retrieval system