KEGG   Pan paniscus (bonobo): 100979514Help
Entry
100979514         CDS       T02283                                 

Gene name
USP27X
Definition
ubiquitin specific peptidase 27, X-linked
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
pps  Pan paniscus (bonobo)
Brite
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100979514 (USP27X)
Peptidases [BR:pps01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100979514 (USP27X)
Transcription machinery [BR:pps03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100979514 (USP27X)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 642 aa AA seqDB search
MKGVRAAIGAESWKRLKETARKRGLAAEAASTRGLRREDSRGRRQLPPPPPSVKVPFGSS
CHSHRAPSGRAGDTVGAEAGAGXXXXXXXRPRPRRGPGGGCLDVDFAVGPPGCSHVNSFK
VGENWRQELRVIYQCFVWCGTPETRKSKAKSCICHVCGTHLNRLHSCLSCVFFGCFTEKH
IHEHAETKQHNLAVDLYYGGIYCFMCKDYVYDKDIEQIAKEEQGEALKLQASTSTEVSHQ
QCSVPGLGEKFPTWETTKPELELLGHNPRRRRITSSFTIGLRGLINLGNTCFMNCIVQAL
THTPILRDFFLSDRHRCEMPSPELCLVCEMSSLFRELYSGNPSPHVPYKLLHLVWIHARH
LAGYRQQDAHEFLIAALDVLHRHCKGDDVGKAANNPNHCNCIIDQIFTGGLQSDVTCQAC
HGVSTTIDPCWDISLDLPGSCTSFWPMSPGRESSVNGESHIPGITTLTDCLRRFTRPEHL
GSSAKIKCGSCQSYQESTKQLTMNKLPVVACFHFKRFEHSAKQRRKITTYISFPLELDMT
PFMASSKESRMNGQLQLPTNSGNNENKYSLFAVVNHQGTLESGHYTSFIRHHKDQWFKCD
DAVITKASIKDVLDSEGYLLFYHKQVLEHESEKVKEMNTQAY
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgaagggggtcagagcagcgattggagccgagagctggaagcgccttaaagagactgcg
cggaaacggggcctggctgcagaagcagcctccactagggggcttcggcgggaggattcc
cgggggcgtcgccagcttccgccgccgcctccttcagtgaaagtcccttttgggtccagc
tgccacagccaccgcgctccctcaggccgggcgggggacaccgtaggagccgaagcagga
gctggnnnnnnnnnnnnnnnnnnnncccggccccggccccggcgcggccctgggggcgga
tgcctggatgtggattttgccgtggggccaccaggctgttctcacgtgaacagctttaag
gtgggagagaactggaggcaggaactgcgggttatctaccagtgcttcgtgtggtgtgga
accccagagaccaggaaaagcaaggcaaagtcgtgcatctgccatgtgtgtggcacccat
ctgaacagactccactcttgcctttcctgtgtcttctttggctgcttcacggagaaacac
attcacgagcacgcagagacgaaacaacacaacttagcagtagacctgtattacggaggt
atatactgctttatgtgtaaggactatgtatatgacaaagacattgagcaaattgccaaa
gaagagcaaggagaagctttgaaattacaagcctccacctcaacagaggtttctcaccag
cagtgttcagtgccaggccttggtgagaaattcccaacctgggaaacaaccaaaccagaa
ttagaactgctggggcacaacccgaggagaagaagaatcacctccagctttacgatcggt
ttaagaggactcatcaatcttggcaacacgtgctttatgaactgcattgtccaggccctc
acccacacgccgatactgagagatttctttctctctgacaggcaccgatgtgagatgccg
agtcccgagttgtgtctggtctgtgagatgtcgtcgctgtttcgggagttgtattctgga
aacccgtctcctcatgtgccctataagttactgcacctggtgtggatacatgcccgccat
ttagcagggtacaggcaacaggatgcccacgagttcctcattgcagcattagatgtcctg
cacaggcactgcaaaggtgatgatgtcgggaaggcggccaacaatcccaaccactgtaac
tgcatcatagaccaaatcttcacaggtggcctgcagtctgatgtcacctgtcaagcctgc
catggcgtctccaccacgatagacccatgctgggacattagtttggacttgcctggctct
tgcacctccttctggcccatgagcccagggagggagagcagtgtgaacggggaaagccac
ataccaggaatcaccaccctcacggactgcttgcggaggtttacgaggccagagcactta
ggaagcagtgccaaaatcaaatgtggtagttgccaaagctaccaggaatctaccaaacag
ctcacaatgaataaattacctgtcgttgcctgttttcatttcaaacggtttgaacattca
gcgaaacagaggcgcaagatcactacatacatttcctttcctctggagctggatatgacg
ccgtttatggcctcaagtaaagagagcagaatgaatggacaattgcagctgccaaccaat
agtggaaacaacgaaaataagtattccttgtttgctgtggttaatcaccaaggaaccttg
gagagtggccactataccagcttcatccggcaccacaaggaccagtggttcaagtgtgat
gatgccgtcatcactaaggccagtattaaggacgtactggacagtgaagggtatttactg
ttctatcacaaacaggtgctagaacatgagtcagaaaaagtgaaagaaatgaacacacaa
gcctactga

DBGET integrated database retrieval system