KEGG   Pan paniscus (bonobo): 100979514Help
Entry
100979514         CDS       T02283                                 

Gene name
USP27X
Definition
ubiquitin specific peptidase 27, X-linked
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
pps  Pan paniscus (bonobo)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 642 aa AA seqDB search
MKGVRAAIGAESWKRLKETARKRGLAAEAASTRGLRREDSRGRRQLPPPPPSVKVPFGSS
CHSHRAPSGRAGDTVGAEAGAGXXXXXXXRPRPRRGPGGGCLDVDFAVGPPGCSHVNSFK
VGENWRQELRVIYQCFVWCGTPETRKSKAKSCICHVCGTHLNRLHSCLSCVFFGCFTEKH
IHEHAETKQHNLAVDLYYGGIYCFMCKDYVYDKDIEQIAKEEQGEALKLQASTSTEVSHQ
QCSVPGLGEKFPTWETTKPELELLGHNPRRRRITSSFTIGLRGLINLGNTCFMNCIVQAL
THTPILRDFFLSDRHRCEMPSPELCLVCEMSSLFRELYSGNPSPHVPYKLLHLVWIHARH
LAGYRQQDAHEFLIAALDVLHRHCKGDDVGKAANNPNHCNCIIDQIFTGGLQSDVTCQAC
HGVSTTIDPCWDISLDLPGSCTSFWPMSPGRESSVNGESHIPGITTLTDCLRRFTRPEHL
GSSAKIKCGSCQSYQESTKQLTMNKLPVVACFHFKRFEHSAKQRRKITTYISFPLELDMT
PFMASSKESRMNGQLQLPTNSGNNENKYSLFAVVNHQGTLESGHYTSFIRHHKDQWFKCD
DAVITKASIKDVLDSEGYLLFYHKQVLEHESEKVKEMNTQAY
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgaagggggtcagagcagcgattggagccgagagctggaagcgccttaaagagactgcg
cggaaacggggcctggctgcagaagcagcctccactagggggcttcggcgggaggattcc
cgggggcgtcgccagcttccgccgccgcctccttcagtgaaagtcccttttgggtccagc
tgccacagccaccgcgctccctcaggccgggcgggggacaccgtaggagccgaagcagga
gctggnnnnnnnnnnnnnnnnnnnncccggccccggccccggcgcggccctgggggcgga
tgcctggatgtggattttgccgtggggccaccaggctgttctcacgtgaacagctttaag
gtgggagagaactggaggcaggaactgcgggttatctaccagtgcttcgtgtggtgtgga
accccagagaccaggaaaagcaaggcaaagtcgtgcatctgccatgtgtgtggcacccat
ctgaacagactccactcttgcctttcctgtgtcttctttggctgcttcacggagaaacac
attcacgagcacgcagagacgaaacaacacaacttagcagtagacctgtattacggaggt
atatactgctttatgtgtaaggactatgtatatgacaaagacattgagcaaattgccaaa
gaagagcaaggagaagctttgaaattacaagcctccacctcaacagaggtttctcaccag
cagtgttcagtgccaggccttggtgagaaattcccaacctgggaaacaaccaaaccagaa
ttagaactgctggggcacaacccgaggagaagaagaatcacctccagctttacgatcggt
ttaagaggactcatcaatcttggcaacacgtgctttatgaactgcattgtccaggccctc
acccacacgccgatactgagagatttctttctctctgacaggcaccgatgtgagatgccg
agtcccgagttgtgtctggtctgtgagatgtcgtcgctgtttcgggagttgtattctgga
aacccgtctcctcatgtgccctataagttactgcacctggtgtggatacatgcccgccat
ttagcagggtacaggcaacaggatgcccacgagttcctcattgcagcattagatgtcctg
cacaggcactgcaaaggtgatgatgtcgggaaggcggccaacaatcccaaccactgtaac
tgcatcatagaccaaatcttcacaggtggcctgcagtctgatgtcacctgtcaagcctgc
catggcgtctccaccacgatagacccatgctgggacattagtttggacttgcctggctct
tgcacctccttctggcccatgagcccagggagggagagcagtgtgaacggggaaagccac
ataccaggaatcaccaccctcacggactgcttgcggaggtttacgaggccagagcactta
ggaagcagtgccaaaatcaaatgtggtagttgccaaagctaccaggaatctaccaaacag
ctcacaatgaataaattacctgtcgttgcctgttttcatttcaaacggtttgaacattca
gcgaaacagaggcgcaagatcactacatacatttcctttcctctggagctggatatgacg
ccgtttatggcctcaagtaaagagagcagaatgaatggacaattgcagctgccaaccaat
agtggaaacaacgaaaataagtattccttgtttgctgtggttaatcaccaaggaaccttg
gagagtggccactataccagcttcatccggcaccacaaggaccagtggttcaagtgtgat
gatgccgtcatcactaaggccagtattaaggacgtactggacagtgaagggtatttactg
ttctatcacaaacaggtgctagaacatgagtcagaaaaagtgaaagaaatgaacacacaa
gcctactga

DBGET integrated database retrieval system