KEGG   Pan paniscus (bonobo): 100979536Help
Entry
100979536         CDS       T02283                                 

Gene name
HEXDC
Definition
hexosaminidase (glycosyl hydrolase family 20, catalytic domain) containing
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
pps  Pan paniscus (bonobo)
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100979536 (HEXDC)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     100979536 (HEXDC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 486 aa AA seqDB search
MSGSTPFQMRLVHLDLKGAPPKVSYLSEIFPLFRALGANGLLIEYEDMFPYEGPLRLLRA
KYAYSPSEIKEILHLAGLNELEVIPLVQTFGHMEFVLKHTAFAHLREVGSFPCTLNPHEA
ESLALVGAMIDQVLELHPGAQRLHVGCDEVYYLGEGEASRRWLQQEQNSTGKLCLSHMRA
VASRVKARRPSVTPLVWDDMLPDLPEDQLAASGVPQLVEPVLWDYTADLDVHGKVLLMQK
YRRCGFPRLWAASAFKGATGPSQAVPPVEHHLRNHVQWLQVAGSGPTDSLQGIILTGWQR
YDHYSVLCELLPAGVPSLAACLQLLLRGGFDEDVKAKVENLLGISSLEITDPVREGAGSF
PGSNILALVTQVSLHLRSSVDALLEGNRYVTGWFSPYHRQRKLIHPVMVQHIQPAALSLL
AQWSTLVQELEAALQLAFYPDAVEEWLEENVHPSLQRLQALLQDLSEVSAPPLPPTSPGR
DVAQDP
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggttccacgccatttcagatgagattagttcatttagaccttaaaggagctcca
ccaaaggtctcgtacctctcagagatttttcctctgttccgtgcactaggtgcaaacggc
ctcctcattgagtatgaagacatgtttccctacgagggccctctgaggctgctgagggcc
aagtacgcctacagcccctctgaaatcaaagagatcttgcatctggctggactcaatgag
ctggaggtgattcccttggtgcagacatttggacacatggagtttgtgctgaagcacacg
gccttcgcccacctgcgggaggtgggctccttcccctgcaccctgaacccccacgaggca
gagtccctggcgctggtgggcgccatgattgaccaggtcctggagctacacccaggcgcc
cagcggctgcacgtcgggtgtgatgaggtctattacctcggagagggggaggcctcgcgc
cggtggctacagcaagagcagaacagcacggggaagttgtgcctgtcacacatgcgggcg
gtggccagccgcgtgaaggcccggcgccccagcgtgacacccctggtgtgggatgacatg
ctcccagacctgcctgaggaccagctcgcagcgtccggggtgccgcagctggtggagccg
gtgctctgggactacacggccgacctggatgtgcacggcaaggtcctcctcatgcagaag
taccggcggtgcggctttccgcggctgtgggcagccagtgccttcaagggtgccacgggg
cccagccaggccgtgccccctgttgagcaccacctcaggaaccacgtgcagtggctgcag
gtggcgggcagcgggcccacggactcactgcagggcatcatcctgaccggctggcagagg
tacgaccactactctgtgctgtgcgagctgctgcccgcaggagtcccgtccctggccgcc
tgcctgcagttgcttctacgcggaggatttgatgaagatgttaaagcgaaagtggagaac
cttctcgggatttccagcctggaaataacggaccctgttagggagggggccggctctttc
cctggcagcaacatccttgcccttgtcacacaagtcagcctccatctgcgcagctctgtg
gacgcgctgctggagggcaacaggtatgtcactggctggttcagcccctaccaccgccag
cggaagctcatccacccggtcatggttcagcacatccagcccgcagcgctcagcctcctg
gcgcagtggagcaccctcgtgcaggagctggaggctgccctgcagctggctttctacccg
gatgccgtggaggagtggctggaggaaaacgtgcaccccagcctgcagcggctgcaagct
ctgctgcaggacctcagcgaggtgtctgcccccccgctgccacccaccagccctggcagg
gacgttgctcaggacccctga

DBGET integrated database retrieval system