KEGG   Pan paniscus (bonobo): 100979558Help
Entry
100979558         CDS       T02283                                 

Gene name
USP21
Definition
(RefSeq) ubiquitin specific peptidase 21
  KO
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.4.19.12]
Organism
pps  Pan paniscus (bonobo)
Brite
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100979558 (USP21)
Peptidases [BR:pps01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100979558 (USP21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 639 aa AA seqDB search
MPQASEHRLGRTREPPVNIQPRVGSKLPFAPRARSKERRNPASGPNPMLRPLPPRPGPPD
ERLKKLELGRGRTSGPRPRGPLRADHGVPLPGSPPPTVALPLPSRTNLARSKSVSSGDLR
PMGIALGGHRGTGELGAALSRLALRPEPPTLRRSTSLRRLGGFPGPPTLFSIRTEPPASH
GSFHMISARSSEPFYSDDKMAHHTLLLGSGHVGLRNLGNTCFLNAVLQCLSSTRPLRDFC
LRRDFRQEVPGGGRAQELTEAFADVIGALWHPDSCEAVNPTRFRAVFQKYVPSFSGYSQQ
DAQEFLKLLMERLHLEINRRGRRAPPILANGPVPSPPRRGGALLEEPELSDDDRANLMWK
RYLEREDSKIVDLFVGQLKSCLKCQACGYRSTTFEVFCDLSLPIPKKGFAGGKVSLRDCF
NLFTKEEELESENAPVCDRCRQKTRSTKKLTVQRFPRILVLHILIFRFLLLLGYLPYILF
PPCFQRIEFSLGKVCHPLFHKMLPVCREWGEDSFQDRRSSPQRPTASQMLLNQGLDLNRF
SASRGSIKKSSVGVDFPLQRLSLGDFASDKAGSPVYQLYALCNHSGSVHYGHYTALCRCQ
TGWHVYNDSRVSPVSENQVASSEGYVLFYQLMQEPPRCL
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgccccaggcctctgagcaccgcctgggccggacccgagagccacctgttaatatccag
ccccgagtgggatccaagctaccatttgcccccagggcccgcagcaaggagcgcagaaac
ccagcctctgggccaaaccccatgttacgacctctgcctccccggccaggtccgcctgat
gaacggctcaagaaactggagctgggacggggacggacctcaggccctcgtcccagaggc
ccccttcgagcagatcatggggttcccctgcctggctcaccacccccaacagtggctttg
cctctcccatctcggaccaacttagcccgttccaagtctgtgagcagtggggacttgcgt
ccaatggggattgccttgggagggcaccgtggcaccggagagcttggggctgcactgagc
cgcttggccctccggcctgagccacccactttgagacgtagcacttctctccgccgccta
gggggctttcctggaccccctaccctgttcagcatacggacagagccccctgcttcccat
ggctccttccacatgatatccgcccggtcctctgagcctttctactctgatgacaagatg
gctcatcacacactgcttctgggctctggtcatgttggccttcgaaacctgggaaacacg
tgcttcctgaatgctgtgctgcagtgtctgagcagcactcgacctcttcgggacttctgt
ctgagaagggacttccggcaagaggtgcctggaggaggccgagcccaagagctcactgaa
gcctttgcagatgtgattggtgccctctggcaccctgactcctgtgaagctgtgaatcct
actcgattccgagctgtcttccagaaatatgttccctccttctctggatacagccagcag
gatgcccaagagttcctgaagctcctcatggagcggctacaccttgaaatcaaccgccga
ggccgccgggctccaccaatacttgccaatggtccagttccctctccaccccgccgagga
ggggctctgctagaagaacctgagttaagtgatgatgaccgagccaacctaatgtggaaa
cgttacctggagcgagaggacagcaagattgtggacctgtttgtgggccagttgaaaagt
tgtctcaagtgccaggcctgtgggtatcgctccacgaccttcgaggttttttgtgacctg
tccctgcccatccccaagaaaggatttgctgggggcaaggtgtctctgcgggattgtttc
aaccttttcactaaggaagaagagctagagtcggagaatgccccagtgtgtgaccgatgt
cggcagaaaactcgaagtaccaaaaagttgacagtacaaagattccctcgaatcctcgtg
ctccatatcctaatcttcagattcttacttctcttaggatacctcccatacattctcttt
cctccatgtttccagagaattgaattttccttaggaaaagtctgccacccccttttccac
aagatgctcccagtgtgtcgggagtggggagaggacagctttcaggatagaagaagttcc
cctcagaggcccactgcctcccaaatgctccttaaccagggcttagatctgaatcgattt
tctgcctcccgaggctccatcaaaaaaagttcagtaggtgtagactttccactgcagcga
ctgagcctaggggactttgccagtgacaaagccggaagtcctgtataccagctgtatgcc
ctttgcaaccactcaggcagcgtccactatggccactacacagccctgtgccggtgccag
actggttggcatgtctacaatgactctcgtgtctcccctgtcagtgaaaaccaggtggca
tccagcgagggctacgtgctgttctaccaactgatgcaggagccaccccggtgcctgtga

DBGET integrated database retrieval system