KEGG   Pan paniscus (bonobo): 100979590Help
Entry
100979590         CDS       T02283                                 

Gene name
UROS
Definition
uroporphyrinogen III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pps  Pan paniscus (bonobo)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100979590 (UROS)
Enzymes [BR:pps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     100979590 (UROS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 291 aa AA seqDB search
MACPKGPQEPRLPIIVFLPYKDCQAIMKVLLLKDAKEDDCGQDPYIRELGLYGLEATLIP
VLSFEFLSLPSFSEKLSHPEDYGGLIFTSPRAVEAAELCLDQNNKTEVWERSLKEKWNAK
SVYVVGNATASLVSKIGLDTEGETCGNAEKLAEYICSRESSALPLLFPCGNLKREILPKA
LKDKGIAMESITVYQTVAHPGIQGNLNSYYSQQGVPASITFFSPSGLTYSLKHIQELSGD
NIDQIKFAAIGPATARALAAQGLPVSCTAESPTPQALATGIRKALQPHGCC
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggcgtgccctaaaggtccccaggagcccagattgcccataatcgtgttcttgccctat
aaggactgccaggcaataatgaaggttcttttactgaaggatgcgaaggaagacgactgt
ggccaggatccgtatatcagggaattaggattatatggacttgaagccactttgatccct
gttttatcatttgagtttttgtctcttcccagtttctctgagaagctttctcatcctgaa
gattacgggggactcatttttaccagccccagagcagtggaagcagcagagttatgtttg
gatcaaaacaataaaactgaagtctgggaaaggtctctgaaagaaaaatggaatgccaag
tcagtgtatgtggttggaaatgctactgcttctctagtgagtaaaattggcctggataca
gaaggagaaacctgtggaaatgcagaaaagcttgcagaatatatttgttccagggagtcc
tcagcactgcctcttctatttccctgtggaaacctcaaaagagaaatcctgccaaaagcg
ctcaaggacaaagggattgccatggaaagcataactgtgtatcagacagttgcacaccca
ggaatccaagggaacctgaacagctactattcccagcagggggttccagccagcatcaca
ttttttagtccctctggcctcacatacagtctcaagcacattcaggagttatctggtgac
aatatcgatcaaattaagtttgcagccatcggccccgctacggctcgcgcgctggccgcc
cagggccttcctgtaagctgcactgcagagagccccacgccacaagccctggccactggc
atcaggaaggctctccagccccatggctgctgctga

DBGET integrated database retrieval system