KEGG   Pan paniscus (bonobo): 100979681Help
Entry
100979681         CDS       T02283                                 

Gene name
POM121L2
Definition
POM121 transmembrane nucleoporin-like 2
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
pps  Pan paniscus (bonobo)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:pps00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100979681 (POM121L2)
Messenger RNA biogenesis [BR:pps03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100979681 (POM121L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1035 aa AA seqDB search
MGSFLSKLELSPSSPAQVRTDLPERPTKRRPPQHLHQVHRVQFVHRAHPAPRYRPVRRRP
NLDPANPTTWLANEAWRRFPMKKSQNSPLGPLPSDWWESYLKRTIWSLRHPRPIWSPVTI
RITPLDQRVPPSTSPEDVIALAGLPPSEELADPCSKETVLRALRECRKGKGRLEEPLFPE
SLDGKRRSPETRPSAFKPLMKNGTLTSFVPRPGPLKRSLHSWGSDHSLTKRPNCSSMSSL
ASIYRGGTLSSKRNAISSSYSSSRNFSDPWKRSVFSVSFETPEWPIKKEKSCHRPYSPVP
LVSDFESLGASESSGQQNQKIPQLPSSPENLVSEIPPPQLGYAVSDENLTLEKKAELQVS
NNAGEDTTEVNTDPFPETWLAIQPSLSLALPSSETDLTQGANPQLENLRKMQKSLGPLAS
PQSTGEATSVAHSPLKTPSLLTPPGCSQSELLPGTSPDSKPTATFILLTPTSPTLPVTDT
TWLPSTSQADRSPMPPDPPAPPTIQSTLLGMVSSPTSHLSASAPPDATSAHLMLKPILGP
LHNSEIGSSSYSRISVTAAASSISSLSTTQGTLTPTFKPIFGSIDPLKTMPMIAPFSSKQ
TPPPFTHASTHHFHGLVKATSVVMSTTLASTSKDSVFKPPLDFGVVNVTSAVGNTYSVPS
TCDTFLLGTAQAFRADFTPATGFIFPPHHHPTIPTVHTVTMFTQVLSSVVQISPRSSTAN
FRGMGSPLPASALVSTNWLASTPSISNLTPAITSPLGSSSRPPFPLSQGANPQPAFGATN
GQKQGPSQPALMPSVSSSFLFGSSAVALPTPMPTPAQPAFISTTQSALGCLTPSASTSQT
PASTWSGIGSIPAGFPISQASTTGFRIVIQTHQSGAFGSVFGSRAPQPFTFGGFVTPMDC
DESGIRMTGPDMSPTSGAFSIGALPSGTTSTMIPFGKGWRQNTEGLPSHRTAFSLGRGSI
SARKTMAPIAQNTPVPGQAKAGSSVGFGMPFPPAQGSVGRGPFRSSASSFSIGAKSKTPK
NREKGHSRRHHAYKK
NT seq 3108 nt NT seq  +upstreamnt  +downstreamnt
atgggcagtttcctgagcaaactggaactttcgccctcgtccccagcccaggtgcgcacc
gacttgcccgagaggcccacgaaacgccggccacctcagcaccttcaccaagttcatcgg
gttcagttcgtccaccgcgcccaccctgccccacggtatagacctgtgaggaggcggcca
aacctggatcctgccaatccaaccacgtggctggccaacgaggcttggaggcgctttccc
atgaagaagtcccagaattcccccctggggcctctcccttcagactggtgggaaagttac
ttaaagcggactatttggtctcttcgacatcccaggccaatttggagcccagtgaccatc
aggatcactcctcttgaccagagagtgcccccttccacttctcctgaagatgtaattgcc
cttgcaggactcccaccctctgaggagctcgcagatccatgttcaaaggagacagtgttg
agggccctcagagagtgcagaaaagggaaagggaggttggaagaaccactattccctgag
agtctggacggtaagagaaggagtccagagaccagaccatcggcatttaagcccctgatg
aaaaatggaacactcacttcttttgtgcccaggcctgggccgctgaagagaagtctccac
tcctggggctcagatcacagcttgactaagaggcccaattgctcctccatgagctccttg
gccagcatatacagaggtggcaccctcagctccaaaaggaatgctatttccagctcttac
agctcttccagaaatttctcagacccttggaagagaagtgttttcagtgtgtcattcgag
acaccagagtggccaataaaaaaggaaaaaagttgtcatcggccttactctccagtccca
ctggtatcagattttgagtccctaggagcatctgaaagttctgggcagcaaaaccagaag
attccacagctgccgtctagccctgagaacctggtgtcagagatcccacctccccagctt
ggttatgcagtctctgatgagaacttgactttggagaagaaagctgagctacaggtaagc
aacaacgcaggagaagatacaactgaggtcaacacagaccctttccctgagacttggctt
gctattcagccttccttatctcttgctctgccttcttcagaaacagatctaacccaggga
gcaaatcctcagttggaaaacttaagaaaaatgcagaagtctctaggtccactggcctct
ccacagtccacaggagaggcaaccagtgtggcccattctcctttgaagacacccagccta
ctgaccccacctgggtgctcacagtcagagctccttccaggcacctctccagactcaaag
cccacagctactttcatcctgctgacccccacctctcccacattaccagttactgacacc
acctggctgccttcaacctctcaggctgacaggtctcccatgcccccagacccacctgca
ccacccaccatccaaagtactttgcttggaatggtgagtagcccaacatcccatctttct
gcatctgcacctcctgatgcaacttctgctcacctcatgttaaaaccgattttggggccc
ctgcacaacagcgagattggaagctcctcatattccagaatttcagtcacagctgcagca
tcttcaatctcttccctttccacaactcagggtaccttaactcctaccttcaagcctatc
tttggcagcatagatccacttaaaactatgcccatgatagctcctttctcctccaagcag
acccctcctccatttactcatgcttctacccatcatttccatggcctggtcaaggccacc
tctgtggtcatgtccaccaccctagccagcacatctaaagactctgtttttaagccacct
ttggattttggtgtagtgaatgtcaccagtgccgtaggcaacacttattctgtcccttcc
acttgcgacactttcctgcttgggactgctcaggccttcagggccgacttcaccccagcc
acaggattcattttcccaccacaccaccatcctacaattcctactgtgcatacagtcacc
atgtttacccaggtcctttccagtgttgtacagatatcccctagaagcagcactgctaat
ttcaggggtatgggcagccctctgcctgcctctgccctagtatccacaaactggcttgca
tcaacccccagcatctccaacctgactccagcaatcacaagtcccttgggatcaagctca
aggccacctttcccactatcccaaggagctaatccccagcctgcatttggtgccacaaat
ggacagaaacaagggccttcccagccagcccttatgccaagtgtcagtagttcttttctt
tttgggagctcagcagtggcattgccaacccccatgccaactccagctcagccagccttc
attagtaccacacagtcagccttggggtgtttgacaccctcagcctccacctctcaaacc
cctgccagcacctggtcaggcattggcagcattccagcaggttttcccattagtcaagct
agtacaactgggtttagaattgtaattcagacccaccaaagtggggcttttggctcagtg
tttggcagcagagccccacaacctttcacttttgggggattcgtgacccctatggactgt
gatgagtctgggatcagaatgactggtccagacatgagccccacctctggagctttcagc
attggagcattgcctagtgggaccactagcaccatgatcccctttggaaaaggctggagg
cagaacactgaaggcctgcccagccaccgcacagctttttccttagggagaggcagcatt
tctgcaagaaagactatggcccccattgctcaaaacaccccagtccctggacaagctaag
gcaggcagcagtgttggctttgggatgccttttccacctgcccagggctctgttgggaga
ggaccttttagatcatcagcctcttcattttccattggcgcaaaatcaaaaaccccaaag
aatcgggagaaagggcattcccgaaggcatcatgcctacaagaagtag

DBGET integrated database retrieval system