KEGG   Pan paniscus (bonobo): 100979698Help
Entry
100979698         CDS       T02283                                 

Gene name
PRF1
Definition
(RefSeq) perforin 1 (pore forming protein)
  KO
K07818  
perforin 1
Organism
pps  Pan paniscus (bonobo)
Pathway
Apoptosis
Natural killer cell mediated cytotoxicity
Type I diabetes mellitus
Autoimmune thyroid disease
Allograft rejection
Graft-versus-host disease
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pps00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100979698 (PRF1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    100979698 (PRF1)
 Human Diseases
  Immune diseases
   05320 Autoimmune thyroid disease
    100979698 (PRF1)
   05330 Allograft rejection
    100979698 (PRF1)
   05332 Graft-versus-host disease
    100979698 (PRF1)
  Cardiovascular diseases
   05416 Viral myocarditis
    100979698 (PRF1)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    100979698 (PRF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
10
AA seq 555 aa AA seqDB search
MAALLLLLGILLLLLPLPVPAPCHTAARSECKRSHKFVPGAWLAGEGVDVTSLRRSGSFP
VDTQRFLRPDGTCTLCENALQEGTLQRLPLALTNWRAQGSGCQRHVTRAKVSSTEAVARD
AARSIRNDWKVGLDVTPKPTGNVHVSVAGSHSQAANFAAQKTHQDQYTFSTDTVECRFYS
FHVVHTPPLHPDFKRALGDLPHHFNASTQPAYLRLISNYGTHFIRAVELGGRISALTALR
TCELALEGLTDNEVEDCLTVEAQVNIGIHGSISAEAKACEEKKKKHKMTASFHQTYRERH
SEVVGGHHTSINDLLFGIQAGPEQYSAWVNSLPGSPGLVDYTLEPLHVLLDSQDPRREAL
RRALSQYLTDRARWRDCSRPCPPGRQKSPRDPCQCVCHGSAVTTQDCCPRQRGLAQLEVT
FIQAWGLWGDWFTATDAYVKLFFGGQELRTSTVWDNNNPVWSVRLDFGDVLLVTGGPLRL
QVWDQDSGGDDDLLGTCDQAPKSGSHEVRCNLNHGHLKFRYHARCLPHLGGGTCLDYVPQ
MLLGEPPGNRSGAVW
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggcggcccttctgctcctcctgggcatccttctcctgctgctgcccctgcccgtccct
gccccatgccacacagccgcacgctcagagtgcaagcgcagccacaagttcgtgcctggt
gcatggctggccggggagggtgtggacgtgaccagcctccgccgctcgggctccttccca
gtggacacacaaaggttcctgcggcccgacggcacctgcaccctctgtgaaaatgcccta
caggagggcaccctccagcgcctgcctctggcgctcaccaactggcgggcccagggctct
ggctgccagcgccatgtaaccagggccaaagtcagctccactgaagctgtggcccgggat
gcggctcgtagcatccgcaacgactggaaggtcgggctggatgtgactcctaagcccacc
ggcaatgtgcatgtgtccgtggccggctcacactcacaggcagccaactttgcagcccag
aagacccaccaggaccagtacaccttcagcactgacacagtggagtgccgcttctacagt
ttccatgtggtacacactcccccgctgcaccctgacttcaagagggccctcggggacctg
ccccaccacttcaacgcctccacccagcccgcctacctcaggcttatctccaactacggc
acccacttcatccgggctgtggagctgggtggccgcatatcggccctcactgccctgcgc
acctgcgagctggccctggaagggctcacggacaacgaggtggaggactgcctgactgtc
gaggcccaggtcaacataggcatccatggcagcatctctgccgaagccaaggcctgtgag
gagaagaagaagaagcacaagatgacggcctccttccaccaaacctaccgggagcgccat
tcggaagtggttggcggccatcacacctccattaacgacctgctgtttgggatccaggcc
gggcccgagcagtactcagcctgggtaaactcgctgcccggcagccctggcctggtggac
tacaccctggaacccctgcacgtgctgctggacagccaggacccgcggcgggaggcactg
aggagggccctgagtcagtacctgacagacagggctcgctggagggactgcagccggccg
tgcccaccagggcggcagaagagcccccgagacccatgccagtgtgtgtgccatggctca
gcggtcaccacccaggactgctgccctcggcagaggggcctggcccagctggaggtgacc
ttcatccaagcatggggcctgtggggggactggttcactgccacggatgcctatgtgaag
ctcttctttggtggccaggagctgaggacgagcaccgtgtgggacaataacaaccccgtc
tggtcagtgcggctggattttggggatgtgctcctggtcacaggggggcccctgaggttg
caggtctgggatcaggactctggcggggacgatgacctccttggcacctgtgatcaggct
cccaagtctggttcccatgaggtgagatgcaacctgaatcatggccacctaaaattccgc
tatcatgccaggtgcttgccccacctgggaggaggcacctgcctggactatgtcccccaa
atgcttctgggggagcctccaggaaaccggagtggggccgtgtggtga

DBGET integrated database retrieval system