KEGG   Pan paniscus (bonobo): 100979806Help
Entry
100979806         CDS       T02283                                 

Gene name
USP26
Definition
ubiquitin specific peptidase 26
Orthology
K11850  
ubiquitin carboxyl-terminal hydrolase 26/29/37 [EC:3.1.2.15]
Organism
pps  Pan paniscus (bonobo)
Brite
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100979806 (USP26)
Peptidases [BR:pps01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100979806 (USP26)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 915 aa AA seqDB search
MASLFLRGFVQIGNCKTGISKSKEAFIEAVERKKEDRLVLYFKSGKYITFRLSDNIQNVV
LKSYRGNQNHLHLTLQNNNVLFIEGLSSTDAEQLKIFLDRVHQNEVQPPVRPGKGGSVFS
STTTQKEINKTSFHKVDEKSSSKSFEIAKGSGTGVLQRIPLLISKSSTLTCGELSENQHK
KRKRMLSSSSEMNEEFLKENNSVEYKKSKADCSRCVSYNREKQLKSKELEENKKLECESS
CIMNATGNPYLDDIGLLQALTEKMVLAFLLQQGYSDGYTKWDKLKLFFELFPEKICHGLP
NLGNTCYMNAVLQSLLSIPSFADDLLNQSFPWGKIPLNALTMCLARLLFLKDIYNIEIKE
MLLLNLKKAISAAAEIFHGNAQNDAHEFLAHCLDQLKDNMEKLNTIWKPKSEFGEDNFPK
QVFADDPDTSGFSCPVITNFELELLHSIACKACGQVILKTELNNYLSINLPQRIKAHPSS
IQSTFDLFFGAEELEYKCAKCEHKTSVGVHSFSRLPRILIVHLKRYSLNEFCALKKNDQE
VIISKYLKVSSHCNEGTRPPLPLSEDGEITDFQLLKVIRKMTSGNISVSWPATKESKDIL
APHIGSDKESEQKKGQTVFKGASRRQQQKYLGKNSKPNELESVYSGDRAFIEKEPLAHLL
TYLEDTSLCQFHKAGGKPASSPGTPLSKVHFQTVPENPKQKKYVKTSKFVAFDRIINPTK
DLYEDKNIRIPERFQKVSEQTQQCDGMRICEQALQQALPQSFPKPGTQGHTKNLLRPTKL
NLQKSNRNSLLALGSNKNPRNKDILDKIKSKAKETKRNDDKGDHTYRLISVVSHLGKTLK
SGHYICDAYDFEKQIWFTYDDMQVLGIQEAQMQEDRRCTGYIFFYMHNEIFEEMLKREEN
AQLNSKEVEETLQKE
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atggcttccctattcctacgtggttttgtccaaatagggaactgcaagactgggatatct
aagtcaaaagaagcattcattgaagcagtggaaagaaagaaggaagatagactggtgctg
tatttcaaaagtggaaaatatatcacttttcggctaagtgataatattcaaaatgtagtc
cttaaatcctatagaggaaaccaaaatcacctgcatttaactttacaaaataataatgtc
ttgtttattgaaggattatcctccacagatgctgaacaattgaagatattcttggacaga
gttcatcaaaacgaggttcagccacctgtgagacctggtaagggtgggagtgtcttttct
agcacaacaacacagaaggaaatcaacaaaacttcattccacaaagttgatgagaaatca
agtagcaaatcttttgagatagcaaaaggaagtgggacaggtgtccttcagaggatacct
ttgcttatatcaaaatcatcaacacttacttgcggagagttatcagaaaatcagcacaag
aagaggaaaagaatgctctcatctagctcagagatgaatgaggaattcttgaaagaaaat
aattctgtagaatacaagaaatccaaggcagattgttcgaggtgtgtaagctataatcga
gagaaacaattgaagtcaaaagagttagaagagaataagaaattggaatgtgaatcttca
tgcatcatgaacgccactggaaatccttacctagatgacattggacttctccaagctctc
actgagaaaatggttttggcatttctgttacaacaagggtatagtgatggttacacaaag
tgggataaattaaaactattttttgaattatttccagagaaaatatgccacggcctcccc
aatttgggaaacacctgttatatgaatgcagtgttacagtctctactttcaatcccatcg
tttgctgatgatttacttaatcagagtttcccatggggtaaaattccccttaatgctctt
accatgtgcttggcacggctactttttttaaaagatatctataatatagaaatcaaggag
atgttactcttgaatcttaaaaaggccatttcagcagctgcagagatattccatggcaat
gcacagaacgatgctcatgagtttttagctcactgtttagatcaactgaaagataacatg
gaaaaactcaacacaatttggaagcctaaaagtgaatttggggaagataattttcctaaa
caggtttttgctgatgatcctgacaccagtgggttttcttgccctgtcattactaatttt
gagttagagttgttgcactccattgcttgtaaagcttgtggtcaggttattctcaagaca
gaactgaataattacctctccatcaaccttccccaaagaataaaagcacatccttcatct
attcagtctacttttgatcttttttttggagcagaagaacttgagtataaatgtgcaaaa
tgtgagcacaagacttctgttggagtgcactcattcagtaggctacctagaatccttatt
gttcacctcaaacgctatagcttgaatgagttttgtgcattaaagaagaatgaccaggaa
gtcatcatttccaaatatttaaaggtgtcttctcattgcaatgaaggcaccagaccacct
cttcccttgagtgaggatggagaaattacagatttccaattattaaaagttattcgaaag
atgacttctggaaacatcagtgtatcatggcctgcaacaaaggaatccaaagatatcctg
gctccacacattggatcagataaggagtctgaacaaaaaaaaggccagacagtctttaaa
ggggcaagcagaagacagcagcaaaagtaccttggaaaaaattctaaaccaaatgagcta
gaatctgtatactcaggagatcgagcattcattgaaaaagaaccgttagctcacttactg
acgtatctggaagatacctcactttgtcagttccacaaagctggaggtaaacctgccagc
agcccaggcacacctctctcaaaagttcactttcaaacagtgcccgaaaatccaaaacaa
aagaaatatgtgaaaaccagtaagtttgtagcttttgataggattatcaatcctactaaa
gatttgtatgaagataaaaatatcagaattccagaaagattccaaaaagtgtctgaacag
actcagcagtgtgacggtatgagaatctgtgaacaagcccttcagcaggcactgcctcaa
agctttccaaagccaggcacccaggggcacacaaagaacctcctaagacctacaaaatta
aatctacagaagtctaacaggaattccctacttgcactgggttccaataagaatccaaga
aacaaagacattttagataagataaaatctaaagccaaggaaacaaaaagaaatgatgat
aagggagatcatacctaccggctcattagtgttgtcagccatcttgggaagactctaaag
tcaggccattatatctgtgatgcctatgactttgagaaacagatctggttcacttacgat
gatatgcaggtgttaggtatccaggaggcccagatgcaggaggataggcgttgcactggg
tacatcttcttttacatgcataatgagatctttgaagagatgctgaaaagagaagagaat
gcccagcttaatagcaaggaggtagaggagacccttcagaaggaataa

DBGET integrated database retrieval system