KEGG   Pan paniscus (bonobo): 100980155Help
Entry
100980155         CDS       T02283                                 

Gene name
UGP2
Definition
UDP-glucose pyrophosphorylase 2
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pps  Pan paniscus (bonobo)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100980155 (UGP2)
   00052 Galactose metabolism
    100980155 (UGP2)
   00500 Starch and sucrose metabolism
    100980155 (UGP2)
   00520 Amino sugar and nucleotide sugar metabolism
    100980155 (UGP2)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     100980155 (UGP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 508 aa AA seqDB search
MSRFVQDLSKAMSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRK
LFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTS
MGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKXLQKYNH
CRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFI
GEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEG
KLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLD
GGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSE
KREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIA
NHGDRIDIPPGAVLENKIVSGNLRILDH
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagatttgtacaagatcttagcaaagcaatgtctcaagatggtgcttctcagttc
caagaagtcattcggcaagagctagaattatctgtgaagaaggaactagaaaaaatactc
accacagcatcatcacatgaatttgagcacaccaaaaaagacctggatggatttcggaag
ctatttcatagatttttgcaagaaaaggggccttctgtggattggggaaaaatccagaga
ccccctgaagattcgattcaaccctatgaaaagataaaggccaggggcttgcctgataat
atatcttctgtgttgaacaaactagtggtggtgaaactcaatggtggtttgggaaccagc
atgggctgcaaaggccctaaaagtctgattggtgtgaggaatgagaatacctttctggat
ctgactgttcagcaaattgaacatttgaataaaacctacaatacagatgttcctcttgtt
ttaatgaactcttttaacacggatgaagataccaaaaaantactacagaagtacaatcat
tgtcgtgtgaaaatctacactttcaatcaaagcaggtacccgaggattaataaagaatct
ttacttcctgtagcaaaggacgtgtcttactcaggggaaaatacagaagcttggtaccct
ccaggtcatggtgatatttacgccagtttctacaactctggattgcttgatacctttata
ggagaaggcaaagagtatatttttgtgtctaacatagataatctgggtgccacagtggat
ctgtatattcttaatcatctaatgaacccacccaatggaaaacgctgtgaatttgtcatg
gaagtcacaaataaaacacgtgcagatgtaaagggcgggacactcactcaatatgaaggc
aaactgagactggtggaaattgctcaagtgccaaaagcacatgtagatgagttcaagtct
gtatcaaagttcaaaatatttaatacaaacaacctatggatttctcttgcagcagttaaa
agactgcaggagcaaaatgccattgacatggaaatcattgtgaatgcaaagactttggat
ggaggcctgaatgtcattcaattagaaactgcagtaggggctgccatcaaaagttttgag
aattctctaggtattaatgtgccaaggagccgttttctacctgtcaaaaccacatcagat
ctcttgctggtgatgtcaaacctctatagtcttaatgcaggatctctgacaatgagtgaa
aagcgggaatttcctacagtgcccttggttaaattaggcagttcttttacaaaggttcaa
gattatctaagaagatttgaaagtataccagatatgcttgaattggatcacctcacagtt
tcaggagatgtgacatttggaaaaaatgtttcattaaagggaacggttatcatcattgca
aatcatggtgacagaattgatatcccacctggagcagtattagagaacaagattgtgtct
ggaaaccttcgcatcttggaccactga

DBGET integrated database retrieval system