KEGG   Pan paniscus (bonobo): 100980372Help
Entry
100980372         CDS       T02283                                 

Definition
liver carboxylesterase 1-like
Orthology
K01044  
carboxylesterase 1 [EC:3.1.1.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
Drug metabolism - other enzymes
Metabolic pathways
Class
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:pps00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 495 aa AA seqDB search
MWLNFRDSSFPLPRCTQDPKVGQFLSELLTNQKENIPLKLSEDCLYLNIYTPADLTKKNR
LLMMVWIHRAGLMVGAASTSDGWVLADHENVVVVTIQHRLGIWGFFSTGDEHSRGNWGHL
DQLAALHWVQDNIASFGGNPGSVTIFGESSGAESVSVLIFSPLSKNLFHRAISESGVALT
PALVDEGDIKPLAEQIANTVGCETTNSAVMAHCLRQKMEEELLETTLKMNFLTLDLHGDP
RESYPHTPMVIDGVVLPKTPKELQTERKFHTVPYIVGFNRKEFGLFLPKQLISYPMSEGK
LDQKTAMSLLWKSYPSVRIPKELIPEAIEEYLGGTDDPVKKKDLFLDLMGDVLFGVPSVT
VARNHRDAGAPTYMYEFQYRPSFSSDMKPKMVIGDHGDELFSVLGAPFLKEGASEEEIRL
SKMVMKFWANFARNGNPNGEGLPHWPEYSQKEGYLQIGANTQAAQKLKDKEVAFWTKLFA
KKAVEKPPQIEQIAL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgaacttcagggattcttctttccccctccccaggtgcacccaagatcccaag
gtagggcagtttctctcagaactattgaccaaccaaaaggagaacattcctcttaagctt
tctgaagactgtctttacctcaatatttacactcctgctgacttgaccaagaaaaacagg
ctgctgatgatggtgtggatccacagagcagggctgatggtgggcgcggcatcaacctct
gatgggtgggtactcgcagaccatgaaaacgtggtggtggtgaccattcagcaccgcctg
ggcatctggggattcttcagcacaggggatgaacacagccgggggaactggggtcacctg
gaccagctggctgccctgcactgggtccaggacaacattgccagcttcggaggaaaccca
ggctctgtgaccatctttggagagtcatcgggagcagaaagtgtctctgttcttattttc
tctccattgtccaagaatctcttccaccgggccatttctgagagtggtgtggccctcact
cctgctctggtggacgagggtgacatcaagccccttgctgagcaaattgctaacactgtt
gggtgtgaaaccaccaactcagctgtcatggctcactgcctgcggcagaagatggaagag
gagctcttggagacgacattgaaaatgaatttcttaactctggacttacatggagacccc
agagagagttacccccacacgcccatggtgattgatggagtggtgctgccaaaaacaccc
aaggagcttcaaactgaaaggaagttccacactgtcccctacatcgtcggatttaacagg
aaggaatttggcttgtttcttccaaaacagttgataagctatccaatgtcagaagggaag
ctggaccagaagacagccatgtcactcttgtggaagtcctatccctctgttcgcattcct
aaggaattgattccagaagccattgaggagtacttaggaggaacagacgaccctgtcaaa
aagaaagacctgttcctggacttaatgggggacgtgctgttcggtgtcccatctgtgact
gtggcccggaaccacagagatgctggagcacccacctacatgtatgagtttcagtaccgt
ccaagcttctcatcagacatgaaacccaagatggtgataggagaccacggggatgagctc
ttctccgtcctcggggccccatttttaaaagagggtgcctcagaagaggagatcagactt
agcaagatggtgatgaaattctgggccaactttgctcgcaatggaaaccccaatggggaa
gggctgccccactggccagagtacagccagaaggaagggtacctgcagattggtgctaac
acccaggcagcccagaagctgaaggacaaggaagtagctttctggaccaaactcttcgcc
aagaaggcagtggagaagccaccccagatagaacaaattgccctgtga

DBGET integrated database retrieval system