KEGG   Pan paniscus (bonobo): 100980561Help
Entry
100980561         CDS       T02283                                 

Gene name
RAE1
Definition
ribonucleic acid export 1
Orthology
K14298  
mRNA export factor
Organism
pps  Pan paniscus (bonobo)
Pathway
RNA transport
Influenza A
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:pps00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100980561 (RAE1)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    100980561 (RAE1)
Messenger RNA biogenesis [BR:pps03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100980561 (RAE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 381 aa AA seqDB search
MLKLAKKRLRRVKMSLFGTTSGFGTSGTSMFGSATTDNHNPMKDIEVTSSPDDSIGCLSF
SPPTLPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCD
KTAKMWDLSSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVL
QLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNK
PTGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGT
LATVGSDGRFSFWDKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNP
QXKNYIFLRNAAEELKPRNKK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagttggcaaagaagcgtctgaggagggtcaaaatgagcctgtttggaacaacc
tcaggttttggaaccagtgggaccagcatgtttggcagtgcaaccacagacaatcacaat
cccatgaaggatattgaagtaacatcatctcctgatgatagcattggttgtctgtctttt
agcccaccaaccttgccggggaactttcttattgcaggatcatgggctaatgatgttcgc
tgctgggaagttcaagacagtggacagaccattccaaaagcccagcagatgcacactggg
cctgtgctcgatgtctgctggagtgacgatgggagcaaagtatttacggcatcgtgtgat
aaaactgccaaaatgtgggacctcagcagtaaccaagcaatacagatcgcacagcatgat
gctcctgttaaaaccatccactggatcaaagctccaaactacagctgtgtgatgactggg
agctgggataagactttaaagttttgggatactcgatcgtcaaatcctatgatggttttg
caactccctgaaaggtgttactgtgctgacgtgatataccccatggctgtggtggcaact
gcagagaggggcctgattgtctatcagctagagaatcaaccttctgaattcaggaggata
gaatctccactgaaacatcagcatcggtgtgtggctatttttaaagacaaacagaacaag
cctactggttttgccctgggaagtatcgaggggagagttgctattcactatatcaacccc
ccgaaccccgccaaagataacttcacctttaaatgtcatcgatctaatggaaccaacact
tcagctcctcaggacatttatgcggtaaatggaatcgcgttccatcctgttcatggcacc
cttgcaactgtgggatctgatggtagattcagcttctgggacaaagatgccagaacaaaa
ctaaaaacttcggaacagttagatcagcccatctcagcttgctgtttcaatcacaatgga
aacatatttgcgtacgcttccagctacgactggtcaaagggacatgaattttataatccc
cagnaaaaaaattacattttcctgcgtaatgcagccgaagagctaaagcccaggaataag
aagtag

DBGET integrated database retrieval system