KEGG   Pan paniscus (bonobo): 100980605Help
Entry
100980605         CDS       T02283                                 

Gene name
PFKP
Definition
phosphofructokinase, platelet
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pps  Pan paniscus (bonobo)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:pps01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pps01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pps00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pps00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pps00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pps00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 784 aa AA seqDB search
MDADDSRAPKGSLRKFLEHLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFI
YEGYQGMVDGGSNIAEADWESVSSILQVGGTIIGSARCQAFRTREGRLKAACNLLQRGIT
NLCVIGGDGSLTGANLFRKEWSGLLEELARNGQIDKEAVQKYAYLNVVGMVGSIDNDFCG
TDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLP
ESPPEEGWEEQMCVKLSENRARKKRLNIIIVAEGAIDTQNKPITSEKIKELVVTQLGYDT
RVTILGHVQRGGTPSAFDRILASRMGVEAVIALLEATPDTPACVVSLNGNHAVRLPLMEC
VQMTQDVQKAMDERRFQDAVRLRGRSFAGNLNTYKRLAIKLPDDQIPKTNCNVAVINVGA
PAAGMNAAVRSAVRVGIADGHRMLAIYDGFDGFAKGQIKEIGWTDVGGWTGQGGSILGTK
RVLPGKYLEEIATQMRTHSINALLIIGGFEAYLGLLELSAAREKHEEFCVPMVMVPATVS
NNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGA
DAAYIFEEPFDIRDLQSNVEHLTEKMKTTIQRGLVLRNESCSENYTTDFIYQLYSEEGKG
VFDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMEWITVKLKEARGRGKKFTTDDSVCVL
GISKRNVIFQPVAELKKQTDFEHRIPKEQWWLKLRPLMKILAKYKASYDVSDSGQLEHVQ
PWSV
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atggacgcggacgactcccgggcccccaagggctccttgcggaagttcctggagcacctc
tccggggccggcaaggccatcggcgtgctgaccagcggcggggatgctcaaggtatgaac
gctgctgtccgtgccgtggtgcgcatgggtatctacgtgggggccaaggtgtacttcatc
tacgagggctaccagggcatggtggacggaggctcaaacatcgcagaggccgactgggag
agtgtctccagcatcctgcaagtgggcgggacgatcattggcagtgcgcggtgccaggcc
ttccgcacgcgggaaggccgcctgaaggctgcttgcaacctgctgcagcgtggcatcacc
aacctgtgtgtgatcggcggggacgggagcctcaccggggccaacctcttccggaaggag
tggagtgggctgctggaggagctggccaggaacggccagatcgataaggaggccgtgcag
aagtatgcctacctcaacgtggtgggcatggtgggctccatcgacaatgacttctgtggc
accgacatgaccatcggtacggactccgccctgcacaggatcatcgaggtcgtcgacgcc
atcatgaccacggcccagagccaccagaggacctttgttctggaggtgatgggacgacac
tgtgggtacctggccctggtgagtgccttggcctgcggtgcagactgggtgttccttcca
gaatctccaccagaggaaggctgggaggagcagatgtgtgtcaaactctcggagaaccgt
gcccggaaaaaaaggctgaatattattattgtggctgaaggagcaattgatacccaaaat
aaacccatcacctctgagaaaatcaaagagctcgtcgtcacgcagctgggctatgacaca
cgtgtgaccatcctcgggcacgtgcagagaggagggaccccttcggcattcgacaggatc
ttggccagccgcatgggagtggaggcggtcatcgccttgctagaggccaccccggacacc
ccagcttgcgtcgtgtcactgaacgggaaccacgccgtgcgcctgccgctgatggagtgc
gtgcagatgactcaggatgtgcagaaggcgatggacgagaggagatttcaagatgcggtt
cgactccgagggaggagctttgcgggcaacctgaacacctacaagcgacttgccatcaag
ctgccggatgatcagatcccaaagaccaattgcaatgtggctgtcatcaacgtgggggcg
cccgcggctgggatgaacgcagccgtacgctcagctgtgcgcgtgggcattgccgacggc
cacaggatgcttgccatctatgatggctttgacggcttcgccaagggccagatcaaagaa
atcggctggacagatgtcgggggctggaccggccaaggaggctccattcttgggacaaaa
cgcgttctcccagggaagtacttggaagagatcgccacacagatgcgcacgcacagcatc
aacgcgctgctgatcatcggtggattcgaggcctacctgggactcctggagctgtcagcc
gcccgggagaagcacgaggagttctgtgtccccatggtcatggttcccgctactgtgtcc
aacaatgtgccgggttccgatttcagcatcggggcagacacggccctgaacactatcacc
gacacctgcgaccgcatcaagcagtccgccagcggaaccaagcggcgcgtgttcatcatc
gagaccatgggcggctactgtggctacctggccaacatgggggggctcgcggccggagct
gatgccgcctacattttcgaagagcccttcgacatcagggatctgcagtccaatgtggag
cacctgacggagaaaatgaagaccaccatccagagaggccttgtgctcagaaatgagagc
tgcagtgaaaactacaccaccgacttcatttaccagctctattcggaagaaggcaaaggc
gtgtttgactgcaggaagaacgtgctgggccacatgcagcagggtggggcaccctctcca
tttgatagaaactttggaaccaaaatctctgccagagctatggagtggatcactgtgaaa
ctcaaggaggcccggggcagaggaaaaaaatttaccaccgatgattccgtttgtgtgctg
ggaataagcaaaagaaacgttatttttcaacctgtggcagagctgaagaagcaaacggat
tttgagcacaggattcccaaagaacagtggtggctcaagctacggcccctcatgaagatc
ctggccaagtacaaggccagctatgacgtgtcagactcaggccagctggagcacgtgcag
ccctggagtgtctga

DBGET integrated database retrieval system