KEGG   Pan paniscus (bonobo): 100980605Help
Entry
100980605         CDS       T02283                                 

Gene name
PFKP
Definition
(RefSeq) phosphofructokinase, platelet
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00010  Glycolysis / Gluconeogenesis
pps00030  Pentose phosphate pathway
pps00051  Fructose and mannose metabolism
pps00052  Galactose metabolism
pps01100  Metabolic pathways
pps01200  Carbon metabolism
pps01230  Biosynthesis of amino acids
pps03018  RNA degradation
pps04152  AMPK signaling pathway
pps05230  Central carbon metabolism in cancer
Module
pps_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100980605 (PFKP)
   00030 Pentose phosphate pathway
    100980605 (PFKP)
   00051 Fructose and mannose metabolism
    100980605 (PFKP)
   00052 Galactose metabolism
    100980605 (PFKP)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    100980605 (PFKP)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    100980605 (PFKP)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100980605 (PFKP)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100980605 (PFKP)
Protein phosphatases and associated proteins [BR:pps01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100980605 (PFKP)
Messenger RNA biogenesis [BR:pps03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100980605 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 100980605
NCBI-ProteinID: XP_003827817
Position
10
AA seq 784 aa AA seqDB search
MDADDSRAPKGSLRKFLEHLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFI
YEGYQGMVDGGSNIAEADWESVSSILQVGGTIIGSARCQAFRTREGRLKAACNLLQRGIT
NLCVIGGDGSLTGANLFRKEWSGLLEELARNGQIDKEAVQKYAYLNVVGMVGSIDNDFCG
TDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLP
ESPPEEGWEEQMCVKLSENRARKKRLNIIIVAEGAIDTQNKPITSEKIKELVVTQLGYDT
RVTILGHVQRGGTPSAFDRILASRMGVEAVIALLEATPDTPACVVSLNGNHAVRLPLMEC
VQMTQDVQKAMDERRFQDAVRLRGRSFAGNLNTYKRLAIKLPDDQIPKTNCNVAVINVGA
PAAGMNAAVRSAVRVGIADGHRMLAIYDGFDGFAKGQIKEIGWTDVGGWTGQGGSILGTK
RVLPGKYLEEIATQMRTHSINALLIIGGFEAYLGLLELSAAREKHEEFCVPMVMVPATVS
NNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGA
DAAYIFEEPFDIRDLQSNVEHLTEKMKTTIQRGLVLRNESCSENYTTDFIYQLYSEEGKG
VFDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMEWITVKLKEARGRGKKFTTDDSVCVL
GISKRNVIFQPVAELKKQTDFEHRIPKEQWWLKLRPLMKILAKYKASYDVSDSGQLEHVQ
PWSV
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atggacgcggacgactcccgggcccccaagggctccttgcggaagttcctggagcacctc
tccggggccggcaaggccatcggcgtgctgaccagcggcggggatgctcaaggtatgaac
gctgctgtccgtgccgtggtgcgcatgggtatctacgtgggggccaaggtgtacttcatc
tacgagggctaccagggcatggtggacggaggctcaaacatcgcagaggccgactgggag
agtgtctccagcatcctgcaagtgggcgggacgatcattggcagtgcgcggtgccaggcc
ttccgcacgcgggaaggccgcctgaaggctgcttgcaacctgctgcagcgtggcatcacc
aacctgtgtgtgatcggcggggacgggagcctcaccggggccaacctcttccggaaggag
tggagtgggctgctggaggagctggccaggaacggccagatcgataaggaggccgtgcag
aagtatgcctacctcaacgtggtgggcatggtgggctccatcgacaatgacttctgtggc
accgacatgaccatcggtacggactccgccctgcacaggatcatcgaggtcgtcgacgcc
atcatgaccacggcccagagccaccagaggacctttgttctggaggtgatgggacgacac
tgtgggtacctggccctggtgagtgccttggcctgcggtgcagactgggtgttccttcca
gaatctccaccagaggaaggctgggaggagcagatgtgtgtcaaactctcggagaaccgt
gcccggaaaaaaaggctgaatattattattgtggctgaaggagcaattgatacccaaaat
aaacccatcacctctgagaaaatcaaagagctcgtcgtcacgcagctgggctatgacaca
cgtgtgaccatcctcgggcacgtgcagagaggagggaccccttcggcattcgacaggatc
ttggccagccgcatgggagtggaggcggtcatcgccttgctagaggccaccccggacacc
ccagcttgcgtcgtgtcactgaacgggaaccacgccgtgcgcctgccgctgatggagtgc
gtgcagatgactcaggatgtgcagaaggcgatggacgagaggagatttcaagatgcggtt
cgactccgagggaggagctttgcgggcaacctgaacacctacaagcgacttgccatcaag
ctgccggatgatcagatcccaaagaccaattgcaatgtggctgtcatcaacgtgggggcg
cccgcggctgggatgaacgcagccgtacgctcagctgtgcgcgtgggcattgccgacggc
cacaggatgcttgccatctatgatggctttgacggcttcgccaagggccagatcaaagaa
atcggctggacagatgtcgggggctggaccggccaaggaggctccattcttgggacaaaa
cgcgttctcccagggaagtacttggaagagatcgccacacagatgcgcacgcacagcatc
aacgcgctgctgatcatcggtggattcgaggcctacctgggactcctggagctgtcagcc
gcccgggagaagcacgaggagttctgtgtccccatggtcatggttcccgctactgtgtcc
aacaatgtgccgggttccgatttcagcatcggggcagacacggccctgaacactatcacc
gacacctgcgaccgcatcaagcagtccgccagcggaaccaagcggcgcgtgttcatcatc
gagaccatgggcggctactgtggctacctggccaacatgggggggctcgcggccggagct
gatgccgcctacattttcgaagagcccttcgacatcagggatctgcagtccaatgtggag
cacctgacggagaaaatgaagaccaccatccagagaggccttgtgctcagaaatgagagc
tgcagtgaaaactacaccaccgacttcatttaccagctctattcggaagaaggcaaaggc
gtgtttgactgcaggaagaacgtgctgggccacatgcagcagggtggggcaccctctcca
tttgatagaaactttggaaccaaaatctctgccagagctatggagtggatcactgtgaaa
ctcaaggaggcccggggcagaggaaaaaaatttaccaccgatgattccgtttgtgtgctg
ggaataagcaaaagaaacgttatttttcaacctgtggcagagctgaagaagcaaacggat
tttgagcacaggattcccaaagaacagtggtggctcaagctacggcccctcatgaagatc
ctggccaagtacaaggccagctatgacgtgtcagactcaggccagctggagcacgtgcag
ccctggagtgtctga

DBGET integrated database retrieval system