KEGG   Pan paniscus (bonobo): 100980786Help
Entry
100980786         CDS       T02283                                 

Gene name
JOSD1
Definition
Josephin domain containing 1
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
pps  Pan paniscus (bonobo)
Brite
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100980786 (JOSD1)
Peptidases [BR:pps01002]
 Cysteine Peptidases
  Family C86
   100980786 (JOSD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 202 aa AA seqDB search
MSCVPWKGDKAKSESLELPQAAPPQIYHEKQRRELCALHALNNVFQDSNAFTRDTLQEIF
QRLSPNTMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVGVIALTNVMGFIM
NLPSSLCWGPLKLPLKRQHWICVREVGGAYYNLDSKLKMPEWIGGESELRKFLKHHLRGK
NCELLLVVPEEVEAHQSWRTDV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagttgtgtgccatggaaaggagacaaggccaaatctgaatcattggagctgccccag
gcagcacccccacaaatctaccatgagaaacagcgcagggagctttgtgccctccacgcc
ctcaataacgtcttccaggacagcaatgccttcacccgggatacgctgcaagagattttc
cagaggttgtctccaaacaccatggtgacacctcacaagaagagcatgctgggaaatggc
aactacgatgtgaatgtcattatggcagcacttcagaccaaaggctatgaagctgtttgg
tgggacaagcgcagggatgtcggtgtcattgccctcactaacgtcatgggcttcatcatg
aatctgccctccagcctatgctggggtccactgaaactgcccctcaaaaggcagcactgg
atctgtgttcgagaggtgggaggggcctactacaacctcgactccaaactcaagatgccc
gagtggattggaggcgagagcgagctcaggaagtttctaaaacatcatttgcgaggaaag
aactgtgaactcctgctggtggtaccagaagaggtagaggctcatcagagttggaggacc
gatgtgtaa

DBGET integrated database retrieval system