KEGG   Pan paniscus (bonobo): 100981208Help
Entry
100981208         CDS       T02283                                 

Gene name
GRIK4
Definition
glutamate receptor, ionotropic, kainate 4
Orthology
K05204  
glutamate receptor, ionotropic kainate 4
Organism
pps  Pan paniscus (bonobo)
Pathway
Neuroactive ligand-receptor interaction
Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100981208 (GRIK4)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    100981208 (GRIK4)
Ion channels [BR:pps04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   100981208 (GRIK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 765 aa AA seqDB search
MPRVSAPLVLLPAWLVMVACSPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLG
KAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSSPASSSIISNICGEKEVPHFK
VAPEEFIKFQFQRFTTLNLHPSNTDISVAVAGILNFFNCTTACLICAKAECLLNLEKLLR
QFLISKDTLSVRMLDDTRDPTPLLKEIRDDKTATIIIHANASMSHTILLKAAELGMVSAY
YTYIFTNLEFSLQRMDSLVDDRVNILGFSIFNQSHAFFQEFAQSLNQSWQENCDHVPFTG
PALSSALLFDAVYAVVTAVQELNRSQEIGVKPLSCGSAQIWQHGTSLMNYLRMVELEGLT
GHIEFNSKGQRSNYALKILQFTRNGFRQIGQWHVAEGLSMDSRLYASNISDTLFNTTLVV
TTILENPYLMLKGNHQEMEGNDRYEGFCVDMLKELAEILRFNYKIRLVGDGVYGVPEANG
TWTGMVGELIARKADLAVAGLTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFL
DPFSPGVWLFMLLAYLAVSCVLFLVARLTPYEWYSPHPCAQGRCNLLVNQYSLGNSLWFP
VGGFMQQGSTIAPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMDVPIESVDDLA
DQTAIEYGTIHGGSSMTFFQNSRYQTYQRMWNYMYSKQPSVFVKSTEEGIARVLNSNYAF
LLESTMNEYYRQRNCNLTQIGGLLDTKGYGIGMPVGMRERNSLFG
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atgccccgcgtctcggcgcctttggtgctgcttcctgcgtggctcgtgatggttgcctgc
agcccgcactccttgaggatcgctgctatcttggatgaccccatggagtgcagcagaggg
gagcggctctccatcaccctggccaagaaccgcatcaaccgtgctcctgagaggctgggc
aaggccaaggtcgaagtggacatctttgagcttctcagagacagcgagtacgagactgca
gaaaccatgtgtcagatcctccccaagggggtggtcgctgtcctcgggccatcgtccagc
ccagcctccagctccatcatcagcaacatctgtggagagaaggaggtccctcacttcaaa
gtggccccagaggagttcatcaagttccagttccagagattcacaaccctgaacctccac
cccagcaacaccgacatcagcgtggctgtagctgggatcctgaacttcttcaactgcacc
accgcctgcctcatctgtgccaaagcagaatgccttttaaacctagagaagctgctccgg
caattccttatctccaaggacacgctgtccgtccgcatgctggatgacacccgggacccc
accccgctcctcaaggagatccgggacgacaagaccgccaccatcatcatccacgccaac
gcctccatgtcccacaccatcctcctgaaggcagccgaacttgggatggtgtcagcctat
tacacatacatcttcactaatctggagttctcactccagagaatggacagccttgtggat
gatcgtgtcaacatcctgggattttccattttcaaccaatcccatgctttcttccaagag
tttgcccagagcctcaaccagtcctggcaggagaactgtgaccatgtgcccttcactggg
cctgcgctctcctcggccctgctgtttgatgctgtctatgctgtggtgactgcggttcag
gaactgaaccggagccaagagatcggcgtgaagcccctgtcttgcggctcggcccagatc
tggcagcacggcaccagcctcatgaactacctgcgcatggtagaattggaaggtcttacc
ggccacattgaattcaacagcaaaggccagaggtccaactacgccttgaaaatcttacag
ttcacaaggaatggttttcggcagatcggccagtggcacgtggcagagggcctcagcatg
gacagccgcctctatgcctccaacatctcggacactctcttcaacaccaccctggtcgtc
accaccatcctggaaaacccatatttaatgctgaaggggaaccaccaggagatggaaggc
aatgaccgctacgagggcttctgtgtggacatgctcaaggagctggcagagatcctccga
ttcaactacaagatccgcctggttggggatggcgtgtacggcgttcccgaggccaacggc
acctggacgggaatggtcggggagctgatcgctaggaaagcagatctggctgtggcaggc
ctcaccattacagctgaacgggagaaggtgattgatttctctaagccattcatgactctg
ggaattagcattctttaccgcgttcatatgggacgcaaacccggctatttctccttcctg
gacccattttctccgggcgtctggctcttcatgcttctagcctatctggccgtcagctgt
gtcctcttcctggtggctcggttgacgccctacgagtggtacagcccacacccatgtgcc
cagggccggtgcaacctcctggtgaaccagtactccctgggcaacagcctctggtttccg
gtcggggggttcatgcagcagggctccaccatcgcccctcgcgccttatccacccgctgt
gtcagtggcgtctggtgggcattcacgctgatcatcatctcatcctacacggccaacctg
gcagccttcctgaccgtgcagcgcatggatgtgcccattgagtcagtggatgacctggct
gaccagaccgccattgaatatggcacaattcacggaggctccagcatgaccttcttccaa
aattcccgctaccagacctaccaacgcatgtggaattacatgtattccaagcagcccagc
gtgttcgtgaagagcacagaggagggaatcgccagggtgttgaattccaactacgccttc
ctcctggaatccaccatgaacgagtactatcggcagcgaaactgcaacctcactcagatt
gggggcctgctggacaccaagggctatgggattggcatgccagtcggtatgcgggagagg
aacagcctctttgggtag

DBGET integrated database retrieval system