KEGG   Pan paniscus (bonobo): 100981245Help
Entry
100981245         CDS       T02283                                 

Gene name
USP33
Definition
ubiquitin specific peptidase 33
Orthology
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.1.2.15]
Organism
pps  Pan paniscus (bonobo)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 911 aa AA seqDB search
MSAFRNHCPHLDSVGEITKEDLIQKSHGTCQDCKVQGPNLWACLENRCSYVGCGESQVDH
STIHSQETKHYLTVNLTTLRVWCYACSKEVFLDRKLGTQPSLPHVRQPHQIQENSVQDFK
IPSNTTLKTPLVAVFDDLDIEADEEDELRARGLTGLKNIGNTCYMNAALQALSNCPPLTQ
FFLDCGGLARTDKKPAICKSYLKLMTELWHKSRPGSVVPTTLFQGIKTVNPTFRGYSQQD
AQEFLRCLMDLLHEELKEQVMEVEEDPQTITTEETMEEDKSQSDVDFQSCESCSNSDRAE
NENGSRCFSEDNNETTMLIQDDENNSEMSKDWQKEKMCNKINKVNSEGEFDKDRDSISQT
VDLNNQETVKVQIHSRASEYITDVHSNDLSTPQILPSNEGVNPRLSASPPKSGNLWPGLA
PPHKKAQSASPKRKKQHKKYRSVISDIFDGTIISSVQCLTCDRVSVTLETFQDLSLPIPG
KEDLAKLHSSSHPTSIVKAGSCGEAYAPQGWIAFFMEYVKRFVVSCVPSWFWGPVVTLQD
CLAAFFARDELKGDNMYSCEKCKKLRNGVKFCKVQKFPEILCIHLKRFRHELMFSTKIST
HVSFPLEGLDLQPFLAKDSPAQIVTYDLLSVICHHGTASSGHYIAYCRNNLNNLWYEFDD
QSVTEVSESTVQNAEAYVLFYRKSSEEAQKERRRISNLLNIMEPSLLQFYISRQWLNKFK
TFAEPGPISNNDFLCIHGGVPPRKAGYIEDLVLMLPQNIWDNLYSRYGGGPAVNHLYICH
TCQIEAEKIEKRRKTELEIFIRLNRAFQKEDSPATFYCISMQWFREWESFVKGKDGDPPG
PIDNTKIAVTKCGNVMLRQGADSGQISEETWNFLQSIYGGGPEVILRPPVVHVDPDILQA
EEKIEVETRSL
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcttttcgaaatcattgtccacatttggattcagttggtgaaataacaaaagaa
gatttgatacaaaaatcccatggtacttgtcaggattgtaaagtccaaggaccaaatctt
tgggcatgtctggagaatagatgttcatatgttggctgtggtgaatcacaagtagatcac
agcaccatacattctcaggagacaaagcattatctaactgtgaaccttaccactcttcga
gtatggtgttatgcttgcagcaaagaagtatttttggataggaaattaggaactcagcct
tcattgcctcatgtaagacaacctcaccaaatacaagaaaacagtgtccaggattttaaa
atacccagtaatacaacattaaaaactcctctggttgccgtatttgatgatctggatata
gaagcggatgaagaagatgaacttagggcaagaggtcttacaggtttgaaaaatattgga
aatacttgttacatgaatgcagctttgcaggctctttctaattgcccacctttgacacag
ttttttcttgattgtggaggactagctcgaacagataagaaacctgccatttgtaaaagt
tatctcaaactaatgacagagctgtggcataaaagcaggccaggatctgttgtgcctact
actctgtttcaaggaattaaaactgtaaatccaacatttcgggggtattctcagcaggat
gctcaagaattccttcgatgtttaatggatctgcttcatgaagaattgaaagagcaagtc
atggaagtagaagaagatccgcaaaccataaccactgaggagacaatggaagaagacaag
agccagtcggatgtagattttcagtcttgtgaatcttgtagcaacagtgatagagcagaa
aatgaaaatggctctagatgcttttctgaagataataatgaaacaacaatgttaattcag
gatgatgaaaacaattcagaaatgtcaaaagattggcaaaaagagaagatgtgcaataag
attaataaagtaaattctgaaggcgaatttgataaagatagagactctatatctcaaaca
gtcgacttaaacaaccaggaaactgtcaaagtgcaaatacacagcagagcttcagaatat
atcactgatgtccattcgaatgacctgtctacaccacagatccttccatcaaatgaaggt
gttaatccacgtttatcggcaagccctcctaaatcaggcaatttgtggccaggattggca
ccaccacacaaaaaagctcagtctgcatctccaaagagaaaaaaacagcacaagaaatac
agaagtgttatttcagacatatttgatggaacaatcattagttcagtgcagtgtctgact
tgtgacagggtgtctgtaaccctcgagacctttcaagatctgtccttgccaattcctggc
aaggaagaccttgctaagctgcattcatcaagtcatccaacttctatagtcaaagcagga
tcatgtggcgaagcatatgctccacaagggtggatagcttttttcatggaatatgtgaag
aggtttgttgtctcatgtgtccctagctggttttggggtccagtagtaaccttgcaagat
tgtcttgctgccttctttgccagagatgaactaaaaggtgacaatatgtacagttgtgaa
aaatgcaaaaagttgagaaatggagtgaagttttgtaaagtacaaaagtttcctgagatt
ttatgcatccaccttaaaagattcagacatgaactaatgttttccaccaaaatcagtacc
catgtttcatttccgctagaaggcttggatcttcagccatttcttgctaaggatagtcca
gctcaaattgtgacatatgatcttctgtcagtcatttgccatcatggaactgcaagtagt
ggacactatatagcctactgccgaaacaatctaaataatctctggtatgaatttgatgat
cagagtgtcactgaagtttcagaatctactgtacaaaatgcagaagcttacgttcttttc
tataggaagagcagcgaagaggcacagaaagagaggagaaggatatcaaatttattgaac
ataatggaaccaagcctccttcagttttatatttctcgacagtggcttaataaatttaag
acctttgccgaacctggccctatttcaaataatgactttctttgtattcatggaggtgtt
cctccaagaaaagctggttatattgaagacctggttttgatgctgcctcagaacatttgg
gataacctatatagcaggtatggtggaggaccagctgtcaaccatctgtacatttgtcat
acttgccaaattgaggcggaaaaaattgaaaaaagaagaaaaactgaattggaaattttt
attcggcttaacagagcgttccaaaaagaggactctccagctactttttattgcatcagt
atgcagtggtttagagaatgggaaagttttgtgaagggtaaagatggagatcctccaggt
cctattgacaatactaagattgcagtcactaaatgtggtaatgtgatgcttaggcaagga
gcagattctggccagatttctgaagaaacatggaattttctgcagtctatttatggtgga
gggcctgaagttatcctacgacctccggttgttcatgttgatccagatatacttcaagca
gaagaaaaaattgaagtagaaactcggtctttgtaa

DBGET integrated database retrieval system