KEGG   Pan paniscus (bonobo): 100981388Help
Entry
100981388         CDS       T02283                                 

Gene name
CPA1
Definition
carboxypeptidase A1 (pancreatic)
Orthology
K08779  
carboxypeptidase A1 [EC:3.4.17.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
Pancreatic secretion
Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:pps00001]
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    100981388 (CPA1)
   04974 Protein digestion and absorption
    100981388 (CPA1)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.1  carboxypeptidase A
     100981388 (CPA1)
Peptidases [BR:pps01002]
 Metallo Peptidases
  Family M14: carboxypeptidase A family
   100981388 (CPA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 419 aa AA seqDB search
MRGLLVLSVLLGAVFGKEDFVGHQVLRISVADEAQVQKVKELEDLEHLQLDFWRGPAHPG
SPIDVRVPFPSIQAVKIFLESHDISYETMIEDVQSLLDEEQEQMFAFQSRARSTDTFNYA
TYHTLEEIYDFLDLLVAENPHLVSKIQIGNTYEGRPIYVLKFSTGGSKRPAIWIDTGIHS
REWVTQASGVWFAKKITQDYGQDAAFTAILDTLDIFLEIVTNPDGFAFTHSTNRMWRKTR
SHTAGSLCIGVDPNRNWDAGFGLSGASSNPCSETYHGKFANSEVEVKSIVDFVKDHGNIK
AFISIHSYSQLLMYPYGYKTEPVPDQDELDQLSKAAVTALASLYGTKFNYGSIIKAIYQA
SGSTIDWTYSQGIKYSFTFELRDTGRYGFLLPASQIIPTAKETWLALLTIMEHTLNHPY
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgcgggggttgctggtgttgagtgtcctgttgggggctgtctttggcaaggaggacttt
gtggggcatcaggtgctccgaatctctgtagccgatgaggcccaggtacagaaggtgaag
gagctggaggacctggagcacctgcagctggacttctggcggggccctgcccaccctggc
tcccccatcgacgttcgagtgcccttccccagcatccaggcggtcaagatctttctggag
tcccacgacatcagctatgagaccatgatcgaggacgtgcagtcactgctggacgaggag
caggagcagatgttcgccttccagtcccgggcgcgctccaccgacacctttaactatgcc
acctaccacaccctagaggagatctatgacttcctggacctgctggtggcagagaacccg
caccttgtcagcaagatccagattggcaacacctatgaagggcgtcccatttacgtgctg
aagttcagcacggggggcagtaagcgtccagccatctggatcgacacgggcatccattcc
cgggagtgggtcacccaggccagtggggtctggtttgcaaagaagatcactcaagactac
gggcaggatgcagctttcaccgccattctcgacaccttggacatcttcctggagatcgtc
accaaccctgatggctttgccttcacgcacagcacgaatcgcatgtggcgcaagactcgg
tcccacacagcaggctccctctgtattggcgtggaccccaacaggaactgggacgccggc
tttgggttgtccggagccagcagtaacccctgctcggagacttaccacggcaagtttgcc
aattccgaagtggaggtcaagtccattgtagactttgtgaaggaccatgggaacatcaag
gccttcatctccatccacagctactcccagctcctcatgtatccctatggctacaaaaca
gaaccagtccctgaccaggatgagctggatcagctttccaaggctgctgtgacagccctg
gcctctctctacgggaccaagttcaactatggcagcatcatcaaggcaatttatcaagcc
agtggaagcactattgactggacctacagccagggcatcaagtactccttcaccttcgag
ctccgggacactgggcgctatggcttcctgctgccagcctcccagatcatccccacggcc
aaggagacgtggctggcgcttctgaccatcatggagcacaccctgaatcacccctactga

DBGET integrated database retrieval system