KEGG   Pan paniscus (bonobo): 100981644Help
Entry
100981644         CDS       T02283                                 

Gene name
USP14
Definition
ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase)
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
pps  Pan paniscus (bonobo)
Brite
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100981644 (USP14)
Peptidases [BR:pps01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100981644 (USP14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 493 aa AA seqDB search
MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGN
IKIKNGMTLLMMGSADALPEEPSAKTVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATV
QCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLH
MAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKK
SLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITK
QSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDMYELCT
PELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDL
QAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLY
GPRRVEIMEEESE
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgccgctctactccgttactgtaaaatggggaaaggagaagtttgaaggtgtagaattg
aatacagatgaacctccaatggtattcaaggctcagctgtttgcgttgactggagtccag
cctgccagacagaaagttatggtgaaaggaggaacgctaaaggatgatgattggggaaac
atcaaaataaaaaatggaatgactctactaatgatggggtcagcagatgctcttccagaa
gaaccctcagccaaaactgtcttcgtagaagacatgacagaagaacagttagcatctgct
atggagttaccatgtggattgacaaaccttggtaacacttgttacatgaatgccacagtt
cagtgtattcgttctgtgcctgaactcaaagatgcccttaaaaggtatgcaggtgccttg
agagcttcaggggaaatggcttcagcgcagtatattactgcagcccttagagatttgttt
gattccatggataaaacttcttccagtattccacctattattctactgcagtttttgcac
atggctttcccacagtttgccgagaagggtgaacaaggacagtatcttcaacaggatgct
aatgaatgttggatacaaatgatgcgagtattgcaacagaaattggaagccatagaggat
gattctgttaaagagacagactcctcatctgcatcggcagcgacaccttctaaaaagaaa
agtttaatcgatcagttcttcggtgttgagtttgaaactaccatgaaatgtacagaatct
gaagaagaagaagtcaccaaaggaaaggaaaatcaacttcagcttagctgttttatcaat
caggaagtcaagtatctttttacaggacttaaattgcgacttcaggaagaaatcaccaaa
cagtctccaacgttgcaaagaaatgccttgtatatcaaatcttccaagatcagccggctg
cctgcttacttgaccattcagatggttcgatttttttataaagagaaggaatctgtgaat
gccaaagttcttaaggatgttaaatttcctcttatgttggatatgtatgaactgtgtaca
ccagaacttcaggagaaaatggtgtcttttcgatccaaattcaaggatctagaagataaa
aaagtgaatcagcagccaaatacaagtgacaaaaagagtagtccccagaaagaagttaag
tatgaacccttttcttttgctgatgatattggctccaataattgtggatactatgactta
caagcagtactaacacaccagggaaggtctagttcttcaggtcattatgtatcatgggtg
aaaaggaaacaagatgaatggattaagtttgatgatgacaaagtcagcatcgtaacacca
gaagatatcttacggctttctggtggtggagactggcatatcgcttacgttctactctat
gggcctcgcagagttgaaataatggaagaggaaagtgaatag

DBGET integrated database retrieval system