KEGG   Pan paniscus (bonobo): 100981671Help
Entry
100981671         CDS       T02283                                 

Gene name
MLYCD
Definition
malonyl-CoA decarboxylase
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
pps  Pan paniscus (bonobo)
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100981671 (MLYCD)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100981671 (MLYCD)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    100981671 (MLYCD)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    100981671 (MLYCD)
Enzymes [BR:pps01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     100981671 (MLYCD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 494 aa AA seqDB search
MRGLGPGLTARRLLPLRFPPRPPGPRLASGQAAGALERAMDELLRRAVPPTPAYELREKT
PAPAEGQCADFVSFYGGLAETAQRAELLGRLARGFGVDHGPGLAEQSAGVLHLRQQQRRR
AVLLQAEDRLRYALVPRYRGLFHHISKLDGGVRFLVQLRADLLEAQALKLVEGPDVREMN
GVLKGMLSEWFSSGFLNLERVTWHSPCEVLQKISEAEAVHPVKNWMDMKRRVGPYRRCYF
FSHCSTPGEPLVVLHVALTGDISSNIQAIVKEHPPSETEEKNKIAAAIFYSISLTQQGLQ
GVELGTFLIKRVVKELQREFPHLGVFSSLSPIPGFTKWLLGLLNSQTKEHGRNELFTDSE
CKEISEITGGPINETLKLLLSSSEWVQSEKLVRALQTPLMRLCAWYLYGEKHRGYALNPV
ANFHLQNGAVLWRINWMADVSLRGITGSCGLMANYRYFLEETGPNSTSYLGSKIIKASEQ
VLSLVAQFQKNSKL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgcgaggcctcgggccaggcttgacggccaggcgtctcctcccgctgcggtttcccccg
cggccgcccgggccccggctggcgagcgggcaggcggccggcgccctggagcgggccatg
gacgagctgctgcgccgcgcggtgccgccgaccccggcctacgagctgcgcgagaagaca
ccggcgcccgccgagggtcagtgcgcggacttcgtgagcttctacggtgggctggccgag
acggcccagcgggccgaactgctgggccgcctggcgcggggcttcggcgtggaccacggc
ccagggttggcggaacagagcgccggcgtgctccatctgcgccagcagcagcggaggcgg
gcggtgctgctgcaggccgaggaccggctgcgctacgcgctggtgccgcgctatcgcggc
ctcttccaccacatcagcaagctggacggcggcgtgcgcttcctggtgcagctgcgggcc
gacctgctggaggcgcaggccctcaagctggtggaggggccggacgtccgggaaatgaat
ggggtgctgaaaggaatgctctcagaatggttttcctccgggttcctgaacctagaacgg
gttacctggcattcaccgtgtgaagtgcttcagaaaatcagtgaggctgaggctgtgcat
cctgtaaaaaactggatggacatgaagcgccgtgttgggccctacagaaggtgttacttc
ttttctcactgttcgacccctggggagcccctggtcgttttgcacgtggcactgactggt
gacatctccagcaacatccaggcaatcgtgaaggaacatcctccgtcagaaacagaagag
aagaacaaaatcgctgctgcgatcttttattccatcagcttgacccagcagggactccaa
ggggtggagctgggaacattcctcataaagcgagtcgtcaaggagttgcagagagagttt
cctcaccttggggtgttttcgagtctgtcacctatacctggtttcaccaaatggcttctc
gggcttctgaactcgcaaacgaaggagcatgggaggaatgaactctttacagattcggaa
tgtaaggaaatctcggagatcacaggtggccccattaacgagaccctcaagctcctcctc
agcagcagcgagtgggtgcagtcggagaagctggtgcgggcgctgcagactccgctgatg
aggctgtgcgcctggtacctgtatggagagaagcaccgcggctacgcgctgaaccccgtg
gccaacttccacctgcagaacggggcggtgctgtggcgcatcaactggatggcggatgtg
agcctcagaggcatcaccggctcctgcggcctgatggccaactaccgctacttcctggag
gagacgggccccaacagcacctcctacctcggctccaagatcatcaaagcctctgagcag
gtcctcagcctagtggcccagtttcaaaagaacagcaagctctga

DBGET integrated database retrieval system