KEGG   Pan paniscus (bonobo): 100981716Help
Entry
100981716         CDS       T02283                                 

Gene name
USP8
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 8
  KO
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
pps  Pan paniscus (bonobo)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100981716 (USP8)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100981716 (USP8)
Peptidases [BR:pps01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100981716 (USP8)
Membrane trafficking [BR:pps04131]
 Endosome - Lysosome transport
  Others
   Others
    100981716 (USP8)
Ubiquitin system [BR:pps04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100981716 (USP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
15
AA seq 1080 aa AA seqDB search
MVYDHGGVCAEWGPWPAGPCPRGGRMVPGAATIDIAPDSEKNALAKRPMEAFLFCNTFRP
GTLVICIEEASSTRYEEAEVRKKLEEKDRQEEAQRLQQKRQETGREDGGTLAKGYLENVL
DSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTDKNISLIIMDARRMQDYQDSCILHS
LSVPEEAISPGVTASWIEAHLPDDSKDTWKKRGNVEYVVLLDWFSSAKDLQIGTTLRSLK
DALFKWESKTVLRNEPLVLEGGYENWLLCYPQYTTNAKVTPPPRRQNEEVSISLDFTYPS
LEESIPSKPAAQTPPASIEVDENIELISDQNERMGPLNISTPVEPVAASKSDVSPIIQPV
PSIKNVPQIDRTKKPAVKLPEEHRIKSESTNHEQQSPQSGKVIPDRSTKPVVFSPTLMLT
DEEKARIHAETALLMEKNKQEKELREKQQEEQKEKLRKEEQEQKAKKKQEAEENEITEKQ
QKAREEMEKKESEQAKKEDKETSAKRGKEITGVKRQSKSEHETSDAKKSVEDRGKRCPTP
EIQKKSTGDVPHTSVTGDSGSGKPFKIKGQPESGILRTGTFREDTDDTERNKAQREPLTR
ARSEEMGRIVPGLPSGWAKFLDPITGTFRYYHSPTNTVHMYPPEMAPSSAPPSTPPTHKA
KPQIPAERDREPSKLKRSYSSPDITQAIQEEEKRKPTVTPTVNRENKPTCYPKAEISRLS
ASQIRNLNPVFGGSGPALTGLRNLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSN
LLGHKGEVAEEFGIIMKALWTGQYRYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMD
GLHEDLNKADNRKRYKEENNDHLDDFKAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLT
CHKKSRTFEAFMYLSLPLASTSKCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKI
EIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDLSQYVIGPKNNLKKYNLFSVSN
HYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVKSSAAYILFYTSLGPRVTDVAT
NT seq 3243 nt NT seq  +upstreamnt  +downstreamnt
atggtctatgaccacggaggcgtgtgtgccgagtggggtccgtggcccgctggcccctgt
cctaggggtggccgcatggtcccaggtgcggccactatagacatagccccagattctgaa
aaaaacgctttagcaaaaagacctatggaagcattcttgttctgtaacacctttcgtcct
ggcactctagtgatttgcattgaggaggcaagttcaactagatatgaagaagctgaagtc
cggaaaaaacttgaggaaaaagacaggcaggaggaagcacagcggctacaacaaaaaagg
caggaaacaggaagagaggatggtggcacattggctaaaggctatttggagaatgttttg
gattccaaagacaaaacccaaaagagcaatggtgaaaagaatgaaaaatgtgagaccaaa
gagaaaggagcaatcacagcaaaggaactatacacaatgatgacggataaaaacatcagc
ttgattataatggatgctcgaagaatgcaggattatcaggattcctgtattttacattct
ctcagtgttcctgaagaagccatcagtccaggagtcactgctagttggattgaagcacac
ctgccagatgattctaaagacacatggaagaagagggggaatgtggagtatgtggtactt
cttgactggtttagttctgccaaagatttacagattggaacaactctccggagtctgaaa
gatgcacttttcaagtgggaaagtaaaactgtcctgcgcaatgagcctttggttttagag
ggaggctatgaaaactggctcctttgttatccccagtatacaacaaatgctaaggtcact
ccacccccacgacgccagaatgaagaggtgtctatctcattggattttacttatccctca
ttggaagaatcaattccttctaaacctgctgcccagacgccacctgcatctatagaagta
gatgaaaatatagaattgataagtgatcaaaatgagagaatgggaccactgaatatatca
actccagttgaaccagttgctgcttctaaatctgatgtttcacccataattcagccagtg
cctagtataaagaatgttccacagattgatcgtactaaaaaaccagcagtcaaattgcct
gaagagcatagaataaaatctgaaagtacaaaccatgagcaacaatctcctcagagtgga
aaagttattcctgatcgttccaccaagccagtagttttttctccaactctcatgttaaca
gatgaagaaaaggctcgtattcatgcagaaactgctcttctaatggaaaaaaacaaacaa
gaaaaagaacttcgggaaaagcagcaagaggaacagaaagagaaactgaggaaggaagaa
caagaacaaaaagccaaaaagaaacaagaagctgaagaaaatgaaattacagagaagcaa
caaaaagcaagagaagaaatggagaagaaagaaagtgaacaggccaagaaagaagataaa
gaaacctcagcaaagaggggcaaagaaataacaggagtaaaaagacaaagtaaaagtgaa
catgaaacttctgatgccaagaaatctgtagaagatagggggaaaaggtgtccaacccca
gaaatacagaaaaagtcaacaggagatgtgccccatacatctgtgacaggggattcaggt
tcaggcaagccatttaagattaaaggacaaccagaaagtggaattctaaggacaggaact
tttagagaggatacagacgataccgaaagaaataaagctcaacgagaacctttgacaaga
gcacgaagtgaagaaatggggaggatcgtaccaggactgccttcaggctgggccaagttt
cttgacccaatcactggaacctttcgttattatcattcacccaccaacactgttcatatg
tacccaccggaaatggctccttcatctgcacctccttccacccctccaactcataaagcc
aagccacagattcctgctgagcgggatagggaaccttccaaactgaagcgctcctactcc
tccccagatataacccaggctattcaagaggaagagaagaggaagccaacagtaactcca
acagttaatcgggaaaacaagccaacatgttatcctaaagctgagatctcaaggctttct
gcttctcagattcggaacctcaatcctgtttttggaggttctggaccagctcttactgga
cttcgtaacttaggaaatacttgttatatgaactcaatattgcagtgcctatgtaacgct
ccacatttggctgattatttcaaccgaaactgttatcaggatgatattaacaggtcaaat
ttgttggggcataaaggtgaagtggcagaagaatttggtataatcatgaaagccctgtgg
acaggacagtatagatatatcagtccaaaggactttaaaatcaccattgggaagatcaat
gaccagtttgcaggatacagtcagcaagattcacaagaattgcttctgttcctaatggat
ggtctccatgaagatctaaataaagctgataatcggaagagatataaagaagaaaataat
gatcatcttgatgactttaaagctgcagaacatgcctggcagaaacacaagcagctcaat
gagtctattattgttgcactttttcagggtcaattcaaatctacagtacagtgcctcaca
tgtcacaaaaagtctaggacatttgaggccttcatgtatttgtctctaccactagcatcc
acaagtaaatgtacattacaggattgccttagattattttccaaagaagaaaaactcaca
gataacaacagattttactgcagtcattgcagagctcgacgggattctctaaaaaagata
gaaatctggaagttaccacctgtgcttttagtgcatctgaaacgtttttcctacgatggc
aggtggaaacaaaaattacagacatctgtggacttcccgttagaaaatcttgacttgtca
cagtatgttattggtccaaagaacaatttgaagaaatataatttgttttctgtttcaaat
cactacggcgggctggatggaggccactacacagcctattgtaaaaatgcagcaagacaa
cggtggtttaagtttgatgatcatgaagtttctgatatctctgtttcttctgtgaaatct
tcagcagcttatatcctcttttatacttcattgggaccacgagtaactgatgtagccaca
taa

DBGET integrated database retrieval system