KEGG   Pan paniscus (bonobo): 100981716Help
Entry
100981716         CDS       T02283                                 

Gene name
USP8
Definition
ubiquitin specific peptidase 8
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
pps  Pan paniscus (bonobo)
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:pps04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 899 aa AA seqDB search
MMTDKNISLIIMDARRMQDYQDSCILHSLSVPEEAISPGVTASWIEAHLPDDSKDTWKKR
GNVEYVVLLDWFSSAKDLQIGTTLRSLKDALFKWESKTVLRNEPLVLEGGYENWLLCYPQ
YTTNAKVTPPPRRQNEEVSISLDFTYPSLEESIPSKPAAQTPPASIEVDENIELISDQNE
RMGPLNISTPVEPVAASKSDVSPIIQPVPSIKNVPQIDRTKKPAVKLPEEHRIKSESTNH
EQQSPQSGKVIPDRSTKPVVFSPTLMLTDEEKARIHAETALLMEKNKQEKELREKQQEEQ
KEKLRKEEQEQKAKKKQEAEENEITEKQQKAREEMEKKESEQAKKEDKETSAKRGKEITG
VKRQSKSEHETSDAKKSVEDRGKRCPTPEIQKKSTGDVPHTSVTGDSGSGKAQREPLTRA
RSEEMGRIVPGLPSGWAKFLDPITGTFRYYHSPTNTVHMYPPEMAPSSAPPSTPPTHKAK
PQIPAERDREPSKLKRSYSSPDITQAIQEEEKRKPTVTPTVNRENKPTCYPKAEISRLSA
SQIRNLNPVFGGSGPALTGLRNLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNL
LGHKGEVAEEFGIIMKALWTGQYRYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDG
LHEDLNKADNRKRYKEENNDHLDDFKAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLTC
HKKSRTFEAFMYLSLPLASTSKCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIE
IWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDLSQYVIGPKNNLKKYNLFSVSNH
YGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVKSSAAYILFYTSLGPRVTDVAT
NT seq 2700 nt NT seq  +upstreamnt  +downstreamnt
atgatgacggataaaaacatcagcttgattataatggatgctcgaagaatgcaggattat
caggattcctgtattttacattctctcagtgttcctgaagaagccatcagtccaggagtc
actgctagttggattgaagcacacctgccagatgattctaaagacacatggaagaagagg
gggaatgtggagtatgtggtacttcttgactggtttagttctgccaaagatttacagatt
ggaacaactctccggagtctgaaagatgcacttttcaagtgggaaagtaaaactgtcctg
cgcaatgagcctttggttttagagggaggctatgaaaactggctcctttgttatccccag
tatacaacaaatgctaaggtcactccacccccacgacgccagaatgaagaggtgtctatc
tcattggattttacttatccctcattggaagaatcaattccttctaaacctgctgcccag
acgccacctgcatctatagaagtagatgaaaatatagaattgataagtgatcaaaatgag
agaatgggaccactgaatatatcaactccagttgaaccagttgctgcttctaaatctgat
gtttcacccataattcagccagtgcctagtataaagaatgttccacagattgatcgtact
aaaaaaccagcagtcaaattgcctgaagagcatagaataaaatctgaaagtacaaaccat
gagcaacaatctcctcagagtggaaaagttattcctgatcgttccaccaagccagtagtt
ttttctccaactctcatgttaacagatgaagaaaaggctcgtattcatgcagaaactgct
cttctaatggaaaaaaacaaacaagaaaaagaacttcgggaaaagcagcaagaggaacag
aaagagaaactgaggaaggaagaacaagaacaaaaagccaaaaagaaacaagaagctgaa
gaaaatgaaattacagagaagcaacaaaaagcaagagaagaaatggagaagaaagaaagt
gaacaggccaagaaagaagataaagaaacctcagcaaagaggggcaaagaaataacagga
gtaaaaagacaaagtaaaagtgaacatgaaacttctgatgccaagaaatctgtagaagat
agggggaaaaggtgtccaaccccagaaatacagaaaaagtcaacaggagatgtgccccat
acatctgtgacaggggattcaggttcaggcaaggctcaacgagaacctttgacaagagca
cgaagtgaagaaatggggaggatcgtaccaggactgccttcaggctgggccaagtttctt
gacccaatcactggaacctttcgttattatcattcacccaccaacactgttcatatgtac
ccaccggaaatggctccttcatctgcacctccttccacccctccaactcataaagccaag
ccacagattcctgctgagcgggatagggaaccttccaaactgaagcgctcctactcctcc
ccagatataacccaggctattcaagaggaagagaagaggaagccaacagtaactccaaca
gttaatcgggaaaacaagccaacatgttatcctaaagctgagatctcaaggctttctgct
tctcagattcggaacctcaatcctgtttttggaggttctggaccagctcttactggactt
cgtaacttaggaaatacttgttatatgaactcaatattgcagtgcctatgtaacgctcca
catttggctgattatttcaaccgaaactgttatcaggatgatattaacaggtcaaatttg
ttggggcataaaggtgaagtggcagaagaatttggtataatcatgaaagccctgtggaca
ggacagtatagatatatcagtccaaaggactttaaaatcaccattgggaagatcaatgac
cagtttgcaggatacagtcagcaagattcacaagaattgcttctgttcctaatggatggt
ctccatgaagatctaaataaagctgataatcggaagagatataaagaagaaaataatgat
catcttgatgactttaaagctgcagaacatgcctggcagaaacacaagcagctcaatgag
tctattattgttgcactttttcagggtcaattcaaatctacagtacagtgcctcacatgt
cacaaaaagtctaggacatttgaggccttcatgtatttgtctctaccactagcatccaca
agtaaatgtacattacaggattgccttagattattttccaaagaagaaaaactcacagat
aacaacagattttactgcagtcattgcagagctcgacgggattctctaaaaaagatagaa
atctggaagttaccacctgtgcttttagtgcatctgaaacgtttttcctacgatggcagg
tggaaacaaaaattacagacatctgtggacttcccgttagaaaatcttgacttgtcacag
tatgttattggtccaaagaacaatttgaagaaatataatttgttttctgtttcaaatcac
tacggcgggctggatggaggccactacacagcctattgtaaaaatgcagcaagacaacgg
tggtttaagtttgatgatcatgaagtttctgatatctctgtttcttctgtgaaatcttca
gcagcttatatcctcttttatacttcattgggaccacgagtaactgatgtagccacataa

DBGET integrated database retrieval system