KEGG   Pan paniscus (bonobo): 100981738Help
Entry
100981738         CDS       T02283                                 

Gene name
USP34
Definition
ubiquitin specific peptidase 34
Orthology
K11853  
ubiquitin carboxyl-terminal hydrolase 34 [EC:3.1.2.15]
Organism
pps  Pan paniscus (bonobo)
Brite
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100981738 (USP34)
Peptidases [BR:pps01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100981738 (USP34)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 3549 aa AA seqDB search
MTSRKICSVATADSSERISDVEGGDGLQLRKEHTLKIFTYINSWTQRQCLCCFKEYKHLE
IFNQVVCALINLVIAQVQVLRDQLCKHCTTINIDSTWQDESNQAEEPLNIDRECNEGSTE
RQKSIEKKSNSTRICNLTEEESSKSSDPFSLWSTDEKEKLLLCVAKIFQIQFPLYTAYKH
NTHPTIEDISTQESNILGAFCDMNDVEVPLHLLRYVCLFCGKNGLSLMKDCFEYGTPETL
PFLIAHAFITVVSNIRIWLHIPAVMQHIIPFRTYVIRYLCKLSDQELRQSAARNMADLMW
STVKEPLDTTLCFDKESLDLAFKYFMSPTLTMRLAGLSQITNQLHTFNDVCNNESLVSDT
ETSIAKELADWLISNNVVEHIFGPNLHIEIIKQCQVILNFLAAEGRLSTQHIDCIWAAAQ
LKHCSRYIHDLFPSLIKNLDPVPLRHLLNLVSALEPSVHTEQTLYLASMLIKALWNNALA
AKAQLSKQSSFASLLNTNIPIGNKKEEEELRRTAPSPWSPAASPQSSDNSDTHQSGGSDI
EMDEQLINRTKHVQQRLSDTEESMQGSSDETANSGEDGSSGPGSSSGHSDGSSNEVNSSH
ASQSAGSPGSEVQSEDIADIEALKEEDEDDDHGHNPPKSSCGTDLRNRKLESQAGICLGD
SQGTSERNGTSSGTGKDLVFNTESLPSVDNRMRMLDACSHSEDPEHDISGEMNATHIAQG
SQESCITRTGDFLGETIGNELFNCRQFIGPQHHHHHHHHHHHHDGHMVDDMLSADDVSCS
SSQVSAKSEKNMADFDGEESGCEEELVQINSHAELTSHLQQHLPNLASIYHEHLSQGPVV
HKHQFNSNAVTDINLDNVCKKGNTLLWDIVQDEDAVNLSEGLINEAEKLLCSLVCWFTDR
QIRMRFIEGCLENLGNNRSVVISLRLLPKLFGTFQQFGSSYDTHWITMWAEKELNMMKLF
FDNLVYYIQTVREGRQKHALYSHSAEVQVRLQFLTCVFSTLGSPDHFRLSLEQVDILWHC
LVEDSECYDDALHWFLNQVRSKDQHAMGMETYKHLFLEKMPQLKPETISMTGLNLFQHLC
NLARLATSAYDGCSNSELCGMDQFWGIALRAQSGDVSRAAIQYINSYYINGKTGLEKEQE
FISKCMESLMIASSSLEQESHSSLMVIERGLLMLKTHLEAFRRRFAYHLRQWQIEGTGIS
SHLKALSDKQSLPLRVVCQPAGLPDKMTIEMYPSDQVADLRAEVTHWYENLQKEQINQQA
QLQEFGQSNRKGEFPGGLMGPVRMISSGHELTTDYDEKALHELGFKDMQMVFVSLGAPRR
ERKGEGVQLPASCLPPPQKDNIPMLLLLQEPHLTTLFDLLEMLASFKPPSGKVAVDDSES
LRCEELHLHAENLSRRVWELLMLLPTCPNMLMAFQNISDEQSNDGFNWKELLKIKSAHKL
LYALEIIEALGKPNRRIRRESTGSYSDLYPDSDDSSEDQVENSKNSWSCKFVAAGGLQQL
LEIFNSGILEPKEQESWTVWQLDCLACLLKLICQFAVDPSDLDLAYHDVFAWSGIAESHR
KRTWPGKSRKAAGDHAKGLHIPRLTEVFLVLVQGTSLIQRLMSVAYTYDNLAPRVLKAQS
DHRSRHEVSHYSMWLLVSWAHCCSLVKSSLADSDHLQDWLKKLTLLIPETAVRHESCNGL
YKLSLSGLDGGDSINRSFLLLAASTLLKFLPDAQALKPIRIDDYEEEPILKPGCKEYFWL
LCKLVDNIHIKDASQTTLLDLDALARHLADCIRSREILDHQDGNVEDDGLTGLLRLATSV
IKHKPPFKFSREGQEFLRDIFNLLFLLPSLKDRQQPKCKSHSSRAAAYDLLVEMVKGSVE
NYRLIHNWVMAQHMQSHAPYKWDYWPHEDVRAECRFVGLTNLGATCYLASTIQQLYMIPE
ARQAVFTAKYSEDMKHKTTLLELQKMFTYLMESECKAYNPRPFCKTYTMDKQPLNTGEQK
DMTEFFTDLITKIEEMSPELKNTVKSLFGGVITNNVVSLDCEHVSQTAEEFYTVRCQVAD
MKNIYESLDEVTIKDTLEGDNMYTCSHCGKKVRAEKRACFKKLPRILSFNTMRYTFNMVT
MMKEKVNTHFSFPLRLDMTPYTEDFLMGKSERKEGFKEVSDHSKDSESYEYDLIGVTVHT
GTADGGHYYSFIRDIVNPHAYKNNKWYLFNDAEVKPFDSAQLASECFGGEMTTKTYDSVT
DKFMDFSFEKTHSAYMLFYKRMEPEEENGREYKFDVSSELLEWIWHDNMQFLQDKNIFEH
TYFGFMWQLCSCIPSTLPDPKAVSLMTAKLSTSFVLETFIHSKEKPTMLQWIELLTKQFN
NSQAACEWFLDRMADDDWWPMQILIKCPNQIVRQMFQRLCIHVIQRLRPVHAHLYLQPGM
EDGSDDMDTSVEDIGGRSCVTRFVRTLLLIMEHGVKPHSKHLTEYFAFLYEFAKMGEEES
QFLLSLQAISTMVHFYMGTKGPENPQVEVLSEEEGEEEEEEEDILSLAEEKYRPAALEKM
IALVALLVEQSRSERHLTLSQTDMAALTGGKGFPFLFQHIRDGINIRQTCNLIFSLCRYN
NRLAEHIVSMLFTSIAKLTPEAANPFFKLLTMLMEFAGGPPGMPPFASYILQRIWEVIEY
NPSQCLDWLAVQTPRNKLAHSWVLQNMENWVERFLLAHNYPRVRTSAAYLLVSLIPSNSF
RQMFRSTRSLHIPTRDLPLSPDTTVVLHQVYNVLLGLLSRAKLYVDAAVHGTTKLVPYFS
FMTYCLISKTEKLMFSTYFMDLWNLFQPKLSEPAIATNHNKQALLSFWYNVCADCPENIR
LIVQNPVVTKNIAFNYILADHDDQDVVLFNRGMLPAYYGILRLCCEQSPAFTRQLASHQN
IQWAFKNLTPHASQYPGAVEELFNLMQLFIAQRPDMREEELEDIKQFKKTTISCYLRCLD
GRSCWTTLISAFRILLESDEDRLLVVFNRGLILMTESFNTLHMMYHEATACHVTGDLVEL
LSIFLSVLKSTRPYLQRKDVKQALIQWQERIEFAHKLLTLLNSYSPPELRNACIDVLKEL
VLLSPHDFLHTLVPFLQHNHCTYHHSNIPMSLGPYFPCRENIKLIGGKSNIRPPRPELNM
CLLPTMVETSKGKDDVYDRMLLDYFFSYHQFIHLLCRVAINCEKFTETLVKLSVLVAYEG
LPLHLALFPKLWTELCQTQSAMSKNCIKLLCEDPVFAEYIKCILMDERTFLNNNIVYTFM
THFLLKVQSQVFSEANCANLISTLITNLISQYQNLQSDFSNRVEISKASASLNGDLRALA
LLLSVHTPKQLNPALIPTLQELLSKCRTCLQQRNSLQEQEAKERKTKDDEGATPIKRRRV
SSDEEHTVDSCISDMKTETREVLTPTSTSDNETRDSSIIDPGTEQDLPSPENSSVKEYRM
EVPSSFSEDMSSIRSQHAEEQSNNGRYDDCKEFKDLHCSKDSTLAEEESEFPSTSISAVL
SDLADLRSCDGQALPSQDPEVALSLSCGHSRGLFSHMQQHDILDTLCRTIESTIHVVTRI
SGKGNQAAS
NT seq 10650 nt NT seq  +upstreamnt  +downstreamnt
atgacttcaaggaagatatgctctgtggctactgctgatagctctgagaggatatcagat
gtagaaggtggtgatggactgcagctcagaaaggaacatactctcaaaatatttacttat
atcaattcctggacacagaggcaatgtctatgctgcttcaaggaatataagcatttggag
atttttaatcaagtagtgtgtgcacttattaacttagtgattgcccaagttcaagtgctc
cgggaccagctttgtaaacattgtactaccattaacatagattccacgtggcaagatgag
agtaatcaagcagaagaaccactgaatatagatagagagtgtaatgaaggaagtacagaa
agacaaaaatcaatagaaaaaaaatcaaactctacaagaatttgtaatctgactgaggag
gaatcttcaaagagttctgatccttttagtttatggagtacagatgagaaggaaaaactc
ttactatgtgtggcaaaaatttttcaaattcagtttcccttatatactgcttacaagcat
aatactcaccctactattgaggatatatcaactcaagaaagtaacatattaggggcattc
tgtgatatgaatgatgtagaagtaccattgcatttgcttcgttatgtatgtttgttttgt
gggaaaaatggcctttctctcatgaaggattgctttgaatatggaactcctgaaactttg
ccatttcttatagcacatgcgtttattacagttgtgtctaatattagaatatggctacat
attcctgctgtcatgcagcacattataccttttaggacctatgttattaggtatttatgc
aagctctcggatcaggagttacgacagagtgcagctcgtaacatggctgacttaatgtgg
agcacagtcaaagaaccattggatacaacattatgctttgataaagaaagcctagatctt
gcatttaagtactttatgtcacctactttgactatgaggttggctggattgagtcagata
acaaatcaactccataccttcaatgatgtgtgcaataatgaatcattagtatcggacaca
gaaacgtccattgcaaaagaacttgcagactggcttattagcaacaatgtggtggagcat
atatttggaccaaatttacatattgagattatcaaacagtgccaagtgattttgaatttt
ttggcagcagaagggcgactgagtactcaacatattgactgtatttgggctgcagcacag
ttgaaacattgtagtcggtatatacatgacttatttccttcactcatcaagaatttggat
cctgtaccacttagacatctacttaatctggtctcagctcttgagccaagtgttcatact
gaacagacactgtacttggcatccatgttaattaaagcactgtggaataacgcactagca
gctaaggctcagttatctaaacagagttcttttgcatctttattaaatactaatattccc
attggaaataagaaagaggaagaagagcttagaagaacagctccatcaccttggtcacct
gcagctagtcctcaaagcagtgataatagcgatacacatcaaagtggaggtagtgacatt
gaaatggatgagcaacttattaatagaaccaaacatgtgcaacaacgactttcagacaca
gaggaatccatgcagggaagttctgacgaaactgccaacagtggtgaagatggaagcagt
ggtcctggtagcagtagtgggcatagtgatggatctagcaatgaggttaattctagccat
gcaagccagtcagctgggagccctggcagtgaggtacagtcagaagacattgcagatatt
gaagccctcaaagaggaagatgaagacgatgatcatggtcataatcctcccaaaagcagt
tgtggtacagatcttcggaatagaaagttagagagtcaagcaggcatttgcctgggggac
tcccaaggcacgtcagaaagaaatgggacaagcagcggaacaggaaaggacctggttttt
aacactgaatcattgccatcagtagataatcgaatgcgaatgctggatgcttgttcacac
tctgaagacccagaacatgatatttcaggggaaatgaatgctactcatatagcacaaggg
tctcaggagtcttgtatcacacgaactggggacttccttggggagactattgggaatgaa
ttatttaattgtcgacaatttattggtccacagcatcaccaccaccaccaccaccatcac
caccaccacgatgggcatatggttgacgatatgctaagtgcagatgatgtcagttgtagt
agctcccaggttagtgcaaaatcagaaaaaaatatggctgattttgatggtgaagaatct
ggatgtgaagaggagctagttcagattaattcacatgcggaactgacatctcacctccaa
caacatcttcccaatttagcttccatttaccatgaacatcttagtcaaggacctgtagtt
cataaacatcaattcaacagtaatgctgttacagacatcaatttggataatgtttgcaag
aaaggaaatactttgttgtgggatatagtccaagatgaagatgcagttaatctttctgaa
ggattaataaatgaagcagagaaacttctttgttcgttagtatgttggtttacagataga
caaattcgaatgagattcattgaaggttgccttgaaaacttgggaaacaacagatcagta
gtaatttcacttcgtcttcttccaaaactatttggtacttttcagcagtttgggagcagt
tacgatacacactggataacaatgtgggcagaaaaagaactgaacatgatgaagcttttc
tttgataatttggtatactacattcaaactgtgagagaaggaagacaaaaacatgcactg
tacagccatagtgctgaagttcaagttcgtcttcaattcttgacttgtgtattttcaact
ctgggatcacctgatcatttcaggttaagtttagagcaagttgacatcttatggcattgt
ttagtagaagattctgaatgttatgatgatgcactccattggtttttaaatcaagttcga
agtaaagatcaacatgctatgggtatggaaacctacaaacatcttttcctggagaagatg
ccccagctaaaacctgaaacaattagcatgactggcttaaacctgtttcagcatctctgt
aacttggctcgattggctaccagtgcctatgatggttgttcaaattctgagctgtgtggt
atggaccaattttggggcattgctttaagagcacaatctggtgatgtcagtcgagcagct
atccagtatattaactcctattatattaatggtaaaacaggtttggagaaggagcaagaa
tttattagtaagtgcatggagagtcttatgatagcttctagcagtcttgaacaggaatca
cactcaagtctcatggttatagaaagaggactccttatgctgaagacacatctggaagcg
tttaggagaaggtttgcatatcatctgagacagtggcaaattgaaggcactggtattagt
agtcatttgaaagcactgagtgacaaacagtctctgccgctaagggttgtatgccagcca
gctggacttcctgacaagatgactattgaaatgtatcctagtgaccaggtagcagatctt
agggctgaagtaactcattggtatgaaaatttacagaaagaacaaataaatcaacaagct
cagcttcaggagtttggtcaaagcaaccgaaaaggagagtttcctggaggcctcatggga
cctgtcaggatgatttcatctggacacgagttaacaacagattatgatgaaaaagcactt
catgagcttggttttaaggatatgcagatggtatttgtatctttgggtgcaccaaggaga
gaacggaaaggggaaggtgttcagctgccagcatcttgcctcccaccccctcagaaggac
aacattccaatgcttttgcttttacaagagcctcatttaactactctttttgatttatta
gagatgcttgcatcatttaaaccaccctcaggaaaagtggcagtggatgatagtgagagc
ttacgatgtgaagaacttcatcttcatgcagaaaatctgtctaggcgggtctgggagcta
ctgatgcttcttcctacatgtcctaatatgttgatggcattccagaatatctcagatgag
cagagtaatgatggatttaattggaaagaacttctcaaaattaagagcgcccacaagcta
ttgtatgctctggaaattattgaagcactgggaaaacctaatagaagaataaggagggag
tctacgggaagttacagtgatctttatccagattcagatgattcaagtgaggatcaagtg
gaaaatagtaaaaattcctggagttgcaagtttgttgctgctggagggcttcaacagtta
ttagaaatttttaattctggaattctagagcctaaagagcaggaatcatggactgtgtgg
cagctagactgtcttgcttgcttgctgaagttaatatgccagtttgcagtagatccatcc
gatttggatttagcttatcatgatgtctttgcctggtctggtatagcggaaagccatagg
aaaagaacctggcctggcaaatcaaggaaggctgctggtgatcatgctaagggtcttcat
ataccacgattaacagaggtatttcttgttcttgtccaaggaaccagtttgattcagcga
cttatgtctgttgcttatacgtatgataatctggctcctagagttttaaaagctcagtct
gatcacaggtctagacatgaagtttcacattattcaatgtggctcttggtgagttgggct
cattgctgttctttagtgaaatctagccttgctgatagtgatcatttacaagattggcta
aagaaattgactctccttattcctgagactgcagttcgtcatgaatcatgcaatggtctc
tataagttatccctgtcaggcctggatggaggagactctatcaatcgttcttttctgcta
ttggctgcctcaacattattgaaatttcttcctgatgctcaagcactcaaacctattagg
atagatgattatgaggaagaaccaatattaaaaccaggatgtaaagagtatttttggttg
ttatgcaaattagttgacaacatacatataaaggacgctagtcagacaacgctcctcgac
ttagatgccttggcaagacatttggctgactgtattcgaagtagggagatccttgatcat
caggatggtaatgtagaagatgatgggcttacaggactcctaaggcttgcaacaagtgtt
attaaacacaaaccaccctttaaattttcaagggaaggacaggaatttttgagagatatc
ttcaatctcctgtttttgttgccaagtctaaaggaccgacaacagccaaagtgcaaatca
cattcttcaagagctgccgcttacgatttgttagtagagatggtaaaggggtctgttgag
aactacaggctaatacacaactgggttatggcacaacacatgcagtcccatgcaccttat
aaatgggattactggcctcatgaagatgtccgtgctgaatgtagatttgttggccttact
aaccttggagctacttgttacttagcttctactattcagcaactttatatgatacctgag
gcaagacaggctgtcttcactgccaagtattcagaggatatgaagcacaagaccactctt
ctggagcttcagaaaatgtttacatatttaatggagagtgaatgcaaagcatataatcct
agacctttctgtaaaacatacaccatggataagcagcctctgaatactggggaacagaaa
gatatgacagagttttttactgatctaattaccaaaatcgaagaaatgtctccagaactg
aaaaataccgtcaaaagtttatttggaggtgtaattacaaacaatgttgtatccttggat
tgtgaacatgttagtcaaactgctgaagagttttatactgtgaggtgccaagtggctgat
atgaagaacatttatgaatctcttgatgaagttactataaaagacactttggaaggtgat
aacatgtatacttgttctcattgtgggaagaaagtacgagctgaaaaaagggcatgtttt
aagaaattgcctcgcattttgagtttcaatactatgagatatacatttaatatggtcacg
atgatgaaagagaaagtgaatacacacttttccttcccattacgtttggacatgacgccc
tatacagaagattttcttatgggcaagagtgagaggaaagaaggttttaaagaagtcagt
gatcattcaaaagactcagagagctatgaatatgacttgataggagtgactgttcacaca
ggaacggcagatggtggacactattatagctttatcagagatatagtaaatccccatgct
tataaaaacaataaatggtatctttttaatgatgctgaggtaaaaccttttgattctgct
caacttgcatctgaatgttttggtggagagatgacgaccaagacctatgattctgttaca
gataaatttatggatttctcttttgaaaagacacacagtgcatatatgctgttttacaaa
cgcatggaaccagaggaagaaaatggcagagaatacaaatttgatgtttcgtcagagtta
ctagagtggatttggcatgataacatgcagtttcttcaagacaaaaacatttttgaacat
acatattttggatttatgtggcaattgtgtagttgtattcccagtacattaccagatcct
aaagctgtgtccttaatgacagcaaagttaagcacttcctttgtcctagagacatttatt
cattctaaagaaaagcccacgatgcttcagtggattgaactgttgacgaaacagtttaat
aatagtcaggcagcttgtgagtggtttttagatcgtatggctgatgacgactggtggcca
atgcagatactaattaagtgccctaatcaaattgtgagacagatgtttcagcgtttgtgt
atccatgtgattcagaggctgagacctgtgcatgctcatctctatttgcagccaggaatg
gaagatgggtcagatgatatggatacctcagtagaagatattggcggtcgttcatgtgtc
actcgctttgtgagaaccctgttattaattatggaacatggtgtaaaacctcacagtaaa
catcttacagagtattttgccttcctttacgaatttgcaaaaatgggtgaagaagagagc
caatttttgctttcattgcaagctatatctacaatggtacatttttacatgggaacaaaa
ggacctgaaaatcctcaagttgaagtgttatcagaggaagaaggggaagaagaagaggag
gaagaagatatcctctctctggcagaagaaaaatacaggccagctgcccttgaaaagatg
atagctttagttgctcttttggttgaacagtctcgatcagaaaggcatttgacattatca
cagactgacatggcagcattaacaggaggaaagggatttcccttcttgtttcaacatatt
cgtgatggcatcaatataagacaaacttgtaatctgattttcagcctgtgtcgatacaat
aatcgacttgcagaacatattgtatctatgcttttcacatcaatagcaaagttgactcct
gaggcagccaatcctttctttaagttgttgactatgctaatggagtttgctggtggacct
ccaggaatgcctccctttgcatcttatattctgcagaggatatgggaggtgattgaatac
aatccttctcagtgtctagattggttggcagtgcagacaccccgaaataaactggcacac
agctgggtcttacagaatatggaaaactgggtcgagcggtttcttttggctcacaattat
cctagagtgaggacttctgcagcttatcttctggtgtcccttataccaagcaattcattc
cgtcagatgttccggtcaacaaggtctttgcacatcccaacccgtgaccttccactcagt
ccagacacaacagtagtcctacatcaggtctacaacgtgctccttggtttgctctcaaga
gccaaactttatgttgatgctgctgttcatggcactacaaagctagtgccctattttagc
tttatgacttactgtttaatttccaaaactgagaagctgatgttttccacatatttcatg
gatttgtggaaccttttccagcctaaactttctgagccagcaatagctacaaatcacaat
aaacaggctttgctttcattttggtacaatgtctgtgctgactgtccagagaatatccgc
cttattgttcagaacccagtggtaaccaagaacattgccttcaattacatccttgctgac
catgatgatcaggatgtggtgctttttaaccgtgggatgctgccagcctactatggcatt
ctgaggctctgctgtgagcagtctcctgcattcacacgacaactggcttctcaccagaac
atccagtgggcctttaagaatcttacaccacatgccagccaataccctggagcagtagaa
gaactgtttaacctgatgcagctgtttatagctcagaggccagatatgagagaagaagaa
ttagaagatattaaacagttcaagaaaacaaccataagttgttacttacgttgcttagat
ggccgctcctgctggacaactttaataagtgccttcagaatactattagaatctgatgaa
gacagacttcttgttgtatttaatcgagggttgattctaatgacagagtctttcaacact
ttgcacatgatgtatcacgaagctacagcttgccatgtgactggagatttagtagaactt
ctgtcaatatttctttcggttttgaagtctacacgcccttatcttcagagaaaagatgtg
aaacaagcattaatccagtggcaggagcgaattgaatttgcccataaactgttaactctt
cttaattcctatagtcctccagaacttagaaatgcctgtatagatgtcctcaaggaactt
gtacttttgagtccccatgattttcttcatactctggttccctttctacaacacaaccat
tgtacttaccatcacagtaatataccaatgtctcttggaccttatttcccttgtcgagaa
aatatcaagctaataggagggaaaagcaatattcggcctccgcgccctgaactcaatatg
tgcctcttgcccacaatggtggaaaccagtaagggcaaagatgacgtttatgatcgtatg
ctgctagactacttcttttcttatcatcagttcatccatctattatgccgagttgcaatc
aactgtgaaaaatttactgaaacattagttaagctgagtgtcctagttgcctatgaaggt
ttgccacttcatcttgcactgttccccaaactttggactgagctatgccagactcagtct
gctatgtcaaaaaactgcatcaagcttttgtgtgaagatcctgttttcgcagaatatatt
aaatgtatcctaatggatgaaagaacttttttaaacaacaacattgtctacacgttcatg
acacatttccttctaaaggttcaaagtcaagtgttttctgaagcaaactgtgccaatttg
atcagcactcttattacaaacttgataagccagtatcagaacctacagtctgatttctcc
aaccgagttgaaatttccaaagcaagtgcttctttaaatggggacctgagggcactcgct
ttgctcctgtcagtacacactcccaaacagttaaacccagctctaatcccaactctgcaa
gagcttttaagcaaatgcaggacttgtctgcaacagagaaactcactccaagagcaagaa
gccaaagaaagaaaaactaaagatgatgaaggagcaactcccattaaaaggcggcgtgtt
agcagtgatgaggagcacactgtagacagctgcatcagtgacatgaaaacagaaaccagg
gaggtcctgaccccaacgagcacttctgacaatgagaccagagactcctcaattattgat
ccaggaactgagcaagatcttccttcccctgaaaatagttccgttaaagaataccgaatg
gaagttccatcttcgttttcagaagacatgtcaagtatcaggtcacagcatgcagaagaa
cagtccaacaatggtagatatgacgattgtaaagaatttaaagacctccactgttccaag
gattctaccctagctgaggaagaatctgagttcccttctacttctatctctgcagttctg
tctgacttagctgacttgagaagctgtgatggccaagctttgccctcccaggaccctgag
gttgctttatctctcagttgtggccattccagaggactctttagtcatatgcagcaacat
gacattttagataccctgtgtaggaccattgaatctacaatccatgtcgtcacaaggata
tctggcaaaggaaaccaagctgcttcttga

DBGET integrated database retrieval system