KEGG   Pan paniscus (bonobo): 100981889Help
Entry
100981889         CDS       T02283                                 

Gene name
RNASE2
Definition
ribonuclease, RNase A family, 2 (liver, eosinophil-derived neurotoxin)
Orthology
K01168  
pancreatic ribonuclease [EC:3.1.27.5]
Organism
pps  Pan paniscus (bonobo)
Brite
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.5  pancreatic ribonuclease
     100981889 (RNASE2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 161 aa AA seqDB search
MVPKLFTSQICLLLLLGLLGVEGSLHVKPPQFTWAQWFETQHINMTSQQCTNAMQVINNY
QRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHQSGSQVPLIHCNLTTPSPQNI
SNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggttccaaaactgttcacttcccaaatttgtctgcttcttctgttggggcttctgggt
gtggagggctcactccatgtcaaacctccacagtttacctgggctcaatggtttgaaacc
cagcacatcaatatgacatcccagcaatgcaccaatgcaatgcaggtcattaacaattat
caacggcgatgcaaaaaccaaaatactttccttcttacaacttttgctaacgtagttaat
gtttgtggtaacccaaatatgacctgtcctagtaacaaaactcgcaaaaattgtcatcaa
agtggaagccaggtgcctttaatccactgtaacctcacaactccaagtccacagaatatt
tcaaactgcaggtatgcgcagacaccagcaaacatgttctatatagttgcatgtgacaac
agagatcaacgacgggaccctccacagtatccggtggttccagttcacctggatagaatc
atctaa

DBGET integrated database retrieval system